KEGG   Sebaldella termitidis: Sterm_1094Help
Entry
Sterm_1094        CDS       T01123                                 

Definition
Formamidopyrimidine-DNA glycosylase-like protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
str  Sebaldella termitidis
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:str00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Sterm_1094
Enzymes [BR:str01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Sterm_1094
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Sterm_1094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1196428..1197261)
Genome map
AA seq 277 aa AA seqDB search
MLEIPESFNLAKQLNQTVKNKVIKNVKAAQSPHKFAFYFNDDPDNYNALLSGKKIEKIEP
IGGQVEITAENIRILFGDGVNARYLPAGEKIPEKHQLLMEFDDNSCIVCTVQMYGVLHAF
THGENDNFYYHVAKTKPSPLSKDFDISYFEKIISDTKPTLSVKALLATEQRIPGFGNGIL
QDILFISGINPKTKIKFLDSSDIDRLFQNIKEILLKMAENGGRDTEKDLFGNYGNYKTVL
SAKTYKEPCPVCGTAITKQAYLGGNIYFCPVCQPLKG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaataccagaaagttttaatcttgcaaaacaattaaaccagactgtaaaaaat
aaagttataaaaaatgttaaagctgcacagtctccgcataaatttgcattttattttaat
gatgatcctgataattacaatgctctgctttcaggaaaaaaaattgaaaagatcgaacct
atcggcggacaagttgaaattactgctgaaaatataagaatattgtttggtgacggagta
aatgcaagatatctgcctgccggagaaaaaattccggaaaagcatcagcttcttatggaa
ttcgatgataattcatgtattgtatgtactgttcagatgtatggagtacttcatgcattt
acccatggagaaaacgataatttttattatcatgtagctaaaacaaaaccttctcctcta
tcaaaagattttgatatcagttattttgagaaaataatatctgatacgaagccgacattg
tcggtaaaagctctgcttgccacggaacagcgcattcccggatttggaaacggtattctt
caggatattttatttatttcaggaattaatcccaaaacaaaaataaaatttcttgacagt
tctgatatagacagactgtttcagaatattaaagaaattttgctgaaaatggctgaaaac
ggcggtcgagatactgaaaaagatctattcggaaactacggaaattataaaacagtttta
tcagccaaaacttacaaagagccttgtcccgtttgcggtactgctataacaaaacaggct
tatctcggcggaaatatttatttttgtcctgtttgccagcccttaaaaggataa

DBGET integrated database retrieval system