KEGG   Sebaldella termitidis: Sterm_1103Help
Entry
Sterm_1103        CDS       T01123                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
str  Sebaldella termitidis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sterm_1103
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sterm_1103
   00052 Galactose metabolism
    Sterm_1103
   00500 Starch and sucrose metabolism
    Sterm_1103
   00520 Amino sugar and nucleotide sugar metabolism
    Sterm_1103
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sterm_1103
   00524 Butirosin and neomycin biosynthesis
    Sterm_1103
Enzymes [BR:str01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sterm_1103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1206970..1207920
Genome map
AA seq 316 aa AA seqDB search
MNYIGIDLGGTKILGALFDDNGTVIYKNKKKTKAKNGIKAVEEQLFSLIDDLTDKSGKEE
IKAIGIGVPGLVDVKTGTVKFAPNIAMNNYPIGDLIRDKYKIDVFVGNDVNVGTLGEWKY
SPEGKSSNFIGIFVGTGIGGGIIIDNKLYTGSGGVAGELGHMTIDSNGAICGCGSRGCLE
AVASKTGIQAEIKARIKRGEDTDIKESLEKEGILKSGPLRAAYDKGDIVVRETVERAAKY
LGVGVANLINIFDPEAVVFGGGVIEELGDIILPIVKEEASRYAMRSIFENVKFEKAQLGD
DAGIMGAFVLAQEGVK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaattatataggaattgatctcgggggaacaaaaatattaggtgcattattcgatgat
aacggaacggtaatatataaaaataagaaaaaaacaaaagcgaagaacggaataaaggct
gtagaggaacagctattctcactgatagatgatctgacagataaaagcggaaaagaagaa
ataaaggcaataggaataggtgtaccgggtcttgtggatgtaaagacgggaaccgtgaaa
tttgctcccaatattgcaatgaataattatccaataggagatttgatcagagataaatat
aaaattgatgtatttgtaggaaatgatgtaaatgtgggaactctgggggaatggaaatat
tctccggaaggtaagtcttcgaactttataggtattttcgtgggaacgggtataggggga
ggaattattattgataataagctttatacaggttccggaggtgtcgcaggggaattggga
catatgacgatagatagcaacggagctatatgcgggtgcggttccagaggatgtcttgaa
gccgtggcttcgaaaacgggaattcaggctgaaataaaagccagaataaaaagaggagaa
gatactgatataaaagaaagccttgaaaaagaagggattctaaaaagcggtccgctgaga
gcagcatatgacaaaggagatatagtggtaagagaaactgtggaaagagcagccaagtat
ctcggagtaggtgtagcaaatctgatcaatatatttgatcctgaagcagtagtattcggg
ggaggtgtaatagaggaactcggtgatattattcttccgattgtaaaagaagaagcttca
cgttatgccatgagaagtatttttgaaaatgtaaaatttgaaaaagcacagctcggcgat
gatgcgggaataatgggagcttttgtgcttgcacaggaaggtgttaaataa

DBGET integrated database retrieval system