KEGG   Sebaldella termitidis: Sterm_1112Help
Entry
Sterm_1112        CDS       T01123                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
str  Sebaldella termitidis
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:str01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:str00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1217723..1219477
Genome map
AA seq 584 aa AA seqDB search
MIYEKYIRVLHIDLTAKKVRIEHREDLYGYLGGVGVASKLLEENMHPELDPLDEKQPVIF
AIGAASTIFPVITKTVATFISPLTGEYGESYAGGRMAMSLFYAGYDAVVITGKSDKPVYI
SIKKNNVEFKDARAMWGLDPNEVERILREREKGHGKRSIVSIGPAGENLSSFACVCVDIF
RHFGRLGLGACFGSKNLKAVLTIGDKDIPIKDFKNYFSVYQEIYKECSETTAMTKYHDLG
TPVNIEPLNAAGALPTRNLQQTSFENSEDISGETFADKNLVRKMSCTGCPVGCIHIGQLR
RQFDKGHEYESLTVAYDYELIFSLGTFLGVKTSEEVLNLIDHVEKTGFDAMSMGVVLGWA
TEALTKGIITEEQTMLPLAFGDSENYAKAIEYTAKGANEFYRDLGKGSAYVSAKYGGSDF
ALEISKNEMAGYHTGYGALVGAAVGTRHSHLCNGGYSIDQSGDSEFDGDKLVDKLYKEEV
ERCMLNSLIICLFARKVYNREKVLKVLNSIGRETTDDELTAIAERIYRTKLRIKKALGYN
QKDIKFPKRFFETVSMNGELKPEIAQELINKFISKNEELMNREV
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgatttatgaaaaatacataagagtactgcatatagatcttacagctaaaaaagtaagg
atagaacacagggaggatctatacggatatcttggcggagtgggtgtagcttccaagctt
cttgaagaaaatatgcatcccgagcttgatccgctggatgaaaaacagcctgtaatattt
gcaatcggtgcggcgagtacaatatttcctgtaattactaaaacagtagcgactttcata
tcacctcttactggagaatacggtgaaagctatgccggcggaagaatggcgatgtcttta
ttttatgccggatatgatgcggtagtaattaccggaaaatcagataaaccggtttatata
tccataaaaaagaataatgtggaattcaaggatgccagagcaatgtgggggcttgatccc
aatgaagtggaaagaatacttcgcgaaagagaaaaaggacatgggaaaagaagtattgtg
agtatcggacctgccggagaaaatctgagcagttttgcatgtgtatgtgtggatattttc
agacactttggaagactgggactcggagcctgctttggaagtaaaaatctgaaagcggtt
ttgactataggagataaagatatccctattaaggactttaaaaattatttttccgtatat
caggaaatatataaagaatgcagtgaaacaacagcgatgacaaaatatcatgatttggga
acaccggtaaatatagaaccgttaaatgctgccggagctcttcctacacgaaatcttcag
cagacatcttttgaaaacagtgaggatatctcaggcgagacctttgcagataagaatctt
gtgagaaaaatgtcatgtacagggtgtcctgtgggctgtatacatatcggccagcttaga
agacagtttgataaaggacatgagtatgagtcgctgacagtagcatatgattatgagctg
atattttcattagggacttttttgggggtgaaaacttccgaagaggtgcttaatctgatt
gatcatgtggaaaagacaggatttgatgcaatgtctatgggtgtggttctcggctgggca
acggaagctctgacaaaaggaattattacagaagaacagacaatgcttccattggctttc
ggtgattctgaaaattatgccaaggctatagaatacactgctaaaggagcaaatgaattt
tacagggatctcggaaaagggtcggcttatgtttcagcaaaatacggcggctcggatttt
gcactggagatatccaaaaatgaaatggccggatatcatacaggttatggggcacttgtg
ggagcagctgtagggacaaggcattcacatttatgcaacggagggtattccatagatcag
agcggcgacagtgaatttgacggggacaaattagtggataagctttataaggaagaagtg
gagagatgtatgcttaattcactcataatatgtctgtttgccagaaaggtttataacagg
gagaaagtattaaaagtattgaattctatcggacgggaaacaacagatgatgagcttaca
gcaatagctgagagaatttacagaacaaagcttcgtataaaaaaggcactcggctataac
cagaaggatataaaatttccaaaaagattttttgaaactgtaagtatgaatggagaacta
aaaccagagattgcacaggaattgataaacaaatttattagtaaaaatgaagagcttatg
aacagggaagtataa

DBGET integrated database retrieval system