KEGG   Sebaldella termitidis: Sterm_1122Help
Entry
Sterm_1122        CDS       T01123                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
str  Sebaldella termitidis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sterm_1122
   01230 Biosynthesis of amino acids
    Sterm_1122
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sterm_1122
   00051 Fructose and mannose metabolism
    Sterm_1122
   00562 Inositol phosphate metabolism
    Sterm_1122
Enzymes [BR:str01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sterm_1122
Exosome [BR:str04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sterm_1122
  Exosomal proteins of bladder cancer cells
   Sterm_1122
  Exosomal proteins of melanoma cells
   Sterm_1122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1228730..1229485
Genome map
AA seq 251 aa AA seqDB search
MRKIIVAGNWKMNKTNKEAVSFLSELKGLVGGINEVETVIGAPFTALSDAVKEVEGSNVK
IAAQNMNPNESGAYTGEISPLMLKELGVEYVILGHSERREYYGENNEFINAKVKAALNHG
LKPILCVGEKLEEREAGKTEDVVANHVQGGLDGITAEEMKNVVIAYEPVWAIGTGKTATP
EQAELVHNFIRLLLIDLYGKEIGEGVTIQYGGSMKPDNAKELISQKNIDGGLIGGASLEA
KSFSEIVKAAL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagataattgtagcaggaaactggaagatgaacaaaacaaataaagaggcagta
agctttttatcagaattaaaaggtctagtaggcgggataaatgaggtagaaactgtaata
ggagcaccatttacagctttatcagatgcggtgaaagaagtagaaggttcaaatgtaaaa
atcgctgcacaaaatatgaatccaaatgaaagcggtgcatatacaggagaaatatcacct
cttatgctgaaagaattaggtgtggaatatgtaatactggggcattctgaaagaagagag
tattatggtgaaaataacgaattcataaatgcaaaagtaaaagctgctctgaatcatggg
ttaaagcctattttatgtgtcggggaaaaactggaagagagagaagcagggaagacagaa
gatgtagtggctaatcatgtgcagggtggacttgacggaataactgcagaagaaatgaaa
aatgtggtaatagcttatgagcctgtatgggcaataggaacaggaaaaacagctacacct
gagcaggctgaacttgttcataacttcataagattgttattaatagatttatacggaaaa
gaaatcggggaaggtgtaactatccaatacggaggttcaatgaaacctgataatgcaaaa
gaattaatttcacaaaagaatatagacggcggactaattggaggagcaagcttagaagca
aaaagtttttctgaaatagtaaaagcagcgttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system