KEGG   Sebaldella termitidis: Sterm_1518Help
Entry
Sterm_1518        CDS       T01123                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
str  Sebaldella termitidis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Sterm_1518
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sterm_1518
   00620 Pyruvate metabolism
    Sterm_1518
   00650 Butanoate metabolism
    Sterm_1518
  Lipid metabolism
   00071 Fatty acid degradation
    Sterm_1518
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sterm_1518
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sterm_1518
   00626 Naphthalene degradation
    Sterm_1518
Enzymes [BR:str01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sterm_1518
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Sterm_1518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1606433..1609024
Genome map
AA seq 863 aa AA seqDB search
MVKDLESLKEMMAKVKAAQAKFAEYSQEEVDRIFKEVALVINNERINLAKMAVEETGMGI
LEDKVIKNHFASEYIYNKYKDEKTCGVLEEDRSFGIKKIATPIGVVAGVIPTTNPTSTTA
FKTLLALKTRNGIIFSPHPRAKGCTIYTAKLALEAAVKAGAPENIIGWIDEPSVDLSKEL
MAEADLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDETADVKMTVNYTLMSKTFDNG
VICASEQAIIVDEKIYDEVRKEFDLRGAYILKKTELDKVRNTIFIDGALNSKIVGQSAYT
IAKMAGVEVPETAKVLIGEVTSVAHDEPFAHEKLSPVLAMYKAKNYDDALDKAAKLVDLG
GLGHTSLLYVNLAEREKIDRFGKRMKTGRTLVNMPSSLGAIGDVFNFKLEPSLTLGCGSW
GGNSVSENVGVKHLINIKTVAERRENMLWFRVPEKIYFKFGSLPVALEELKGSKKRAFIV
TDSALAKLGFTNHITKVLDELNIDYRIFSDVVEDPTLSSAQKGAQAMLDYNPDVIIALGG
GSAMDAAKIMWVLYEHPEVKFHDLSMRFMDIRKRIYQFPKMGVKAEFIAVATSAGTGSEV
TPFSVITDDETGVKYPLADYELTPDVAIIDPELMLTMPRGLTVASGIDVLTHAVESYVST
LATEFTKPISLESMKLVFDYLPESVEGGAKAIHAKEKMANASCLAGMAFANAFLGICHSM
AHKLGGKFHVPHGIANALLLNEVIKFNAVESPTKMGVFPQYKYPDAKNRYVEIANFLGVN
GKTDDDKITNLIKAIDGLKDKIGIPASIKEFGVPEKEFLEAVDQLALDAFDDQCTGANPR
YPLVTELKEIYLKAYYGADYQGK
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggatttggaatcattaaaagaaatgatggcaaaagtaaaagcagcgcaggca
aaattcgctgaatacagccaagaagaagtagacagaatctttaaagaagtcgctttagta
attaacaatgaaagaattaatcttgcaaaaatggctgttgaggaaacaggaatgggtatt
ttggaggataaggtaataaaaaatcattttgcctctgaatatatttataataaatacaag
gatgaaaaaacttgcggcgtacttgaagaagacagatcattcggaatcaaaaaaatagcc
acaccaataggagtggtagccggggtaatacctacaacaaaccctacatcgactacagcg
ttcaaaacactgcttgctctgaaaacaagaaacggaattatattttctccgcatccaaga
gcaaaaggatgtactatctatactgcgaaactagctttagaggctgcagtgaaagctgga
gcacctgaaaatatcattgggtggatagatgaaccgagtgtggatctttctaaggaacta
atggcagaagctgatctgattcttgcaactggaggaccgggaatggttaaagctgcttac
tcatcaggaaaacctgcaataggggtaggagcaggaaatacaccggtagtagtagacgaa
acagctgatgtaaaaatgactgtaaactatacattaatgtcaaaaacttttgacaacggg
gtaatctgtgcatctgagcaggcaataatagtagacgagaagatttatgacgaagtaaga
aaagaatttgacttaagaggagcatatattcttaagaaaactgaactggataaagtaaga
aatacaatatttatagatggtgcattaaattctaaaatagtaggtcaaagtgcatatact
atagcaaaaatggcaggagtggaagttccggaaactgcaaaggttcttatcggggaagta
acttctgtggcacatgacgagccgtttgcacatgagaaattatctccggttctggctatg
tacaaagcaaagaattacgacgatgcattggataaagcagcaaagctggtagatcttgga
ggactgggacatacatcgcttctttatgtaaatcttgctgaaagagaaaaaatagacaga
ttcggtaaaagaatgaaaacaggaagaactcttgtaaatatgccttcatcactgggagca
ataggagatgtatttaactttaaattagagccgtcattaacattaggatgtgggtcttgg
ggaggaaactctgtttctgaaaacgtaggagtaaaacatttgattaatataaaaacagtt
gctgaaaggagagaaaatatgctttggtttagagttcctgaaaaaatctattttaaattt
ggttcgcttcctgtagctttagaagaattgaaggggtctaaaaagagagcatttatcgta
acagattcggcgctggcaaaattaggatttactaatcatattacaaaggtacttgatgaa
ttaaatatagactacagaatattctctgatgtagtggaggatccgacattatcatcagct
caaaaaggagcacaggcaatgcttgactacaatcctgatgtgattatagcacttggcgga
ggatctgcaatggatgctgccaaaatcatgtgggtgttatatgagcatcctgaagtaaaa
ttccatgacttatcaatgagatttatggatataagaaagagaatatatcaatttcctaag
atgggagtaaaggcagaatttatagctgtagcaacatcagctggaacaggttcggaagtt
acaccgttctcagtaataactgatgatgaaactggagtaaaatatccacttgctgattat
gaattaacacctgatgtggcaataattgatcctgaattaatgcttactatgcctagaggc
ttaacagtggcatctggtatagacgtacttacacatgctgtggaatcatatgtttctaca
cttgctactgagtttacaaagcctatatcgctggaatcaatgaagctggtattcgactat
ctgcctgaatcagtggaaggcggagcaaaagcaattcatgcaaaagaaaaaatggctaat
gcatcatgtcttgcaggtatggctttcgcaaatgcattccttggaatatgtcactcaatg
gcacataaactgggaggaaaattccatgtacctcatggtatagcaaatgcactgcttctt
aatgaagtaatcaagtttaatgctgtggaaagtccaactaaaatgggagtattccctcag
tacaaatatcctgatgctaaaaacagatatgtggaaatagcaaacttcttaggagtaaac
ggtaaaacagatgatgataaaataactaatctgataaaagcaatagacggtctgaaggat
aaaataggaatcccggcttctataaaagaattcggagttcctgaaaaagaatttttagaa
gctgttgaccaacttgcacttgatgcatttgacgatcagtgtacaggagcaaacccaaga
tatccgttagtaactgagctaaaagaaatatacttaaaagcatactatggtgctgattat
caaggcaaataa

DBGET integrated database retrieval system