KEGG   Sebaldella termitidis: Sterm_1523Help
Entry
Sterm_1523        CDS       T01123                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
str  Sebaldella termitidis
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:str00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1617606..1619291
Genome map
AA seq 561 aa AA seqDB search
MAAIRERLIKVYGEETAGKYTEIIETMINNAQKKQKEQKKVKWDEKDVVLITYGDQIYKT
GEKTLKTFDDFSEKYFKNVFELVHFLPFFPYSSDDGFSVIDYKKIHENMGDWADIEKIRK
NFRLMFDFVCNHISAKSEWFQEYLKCNPEYDNFFIAIDKNTDLSLVTRPRTLPLLSEFDT
ACGKKYIWTTFSDDQIDLNFENPEVLIKMLDVLLFYLEKGADWIRLDAVGFMWKEAGTTC
IHHEKTHEIIKLFRDAAEQTAPGTVIITETNVPHKDNISYFGNGRDEAQMVYQFPLPPLV
IYTFMHGDSSAISRWASNLEVPGDEVTYFNFLASHDGIGINPVRGIIEEEEILEMVRNLE
KEGALVSYKKNTDGTLSPYEINSSYINAVSRKNDTDEMKTGKFLNAQAVLLAFKGVPAIY
VHSILGSENYYEGVKITGMNRTINREKLEYGKITSELENKNGIRSRIYNRLKELIKARKT
EKSFNPDAEQIIQNFGSEVFSFIRISVDKEEKILIINNISDKEITLKIPYEIKRTVIAEN
SLTDENHIRLASYGFTWLEIK
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
ttggcagcgattagagaaagactgataaaagtgtacggagaagaaacggccggaaaatat
acagaaataatagaaaccatgataaataatgcccagaaaaaacaaaaggaacagaaaaaa
gtgaaatgggatgaaaaggatgtagttttgataacatacggagaccagatatacaaaaca
ggcgaaaaaacactgaaaacatttgatgacttttcagagaaatattttaaaaatgtattt
gaattggtgcattttcttccattttttccatattcatcagatgacggattttctgtaatt
gattataaaaaaatacatgaaaatatgggagattgggctgatatagaaaaaatcaggaag
aatttcagattaatgtttgattttgtatgcaatcatatatctgcgaaaagtgagtggttt
caggaatatttgaaatgtaatcccgagtatgataattttttcatagcaatagataagaat
actgatcttagtctggttacaagacccagaacacttccgctgctttcggaatttgatact
gcctgcggtaaaaaatatatctggacaacatttagtgatgatcagatagatttgaatttc
gaaaatcctgaggttctgataaaaatgcttgatgtattactcttttatctggaaaaaggt
gcagactggataagactggatgctgtgggatttatgtggaaggaagcggggactacctgc
atacaccatgaaaagacacatgaaataataaagcttttcagggatgcagcggaacaaact
gctccgggaactgtaataataactgagacaaatgttcctcataaagataatatttcatat
ttcgggaacggaagagacgaagcacagatggtatatcagtttccgcttcctccgctggtg
atttacacatttatgcacggggacagctcggcaatcagcagatgggcttcgaatctggaa
gttccaggtgatgaagtgacatattttaattttcttgcttcgcatgacggaatagggata
aatcctgtaagaggtattattgaagaagaagaaattttggaaatggtaagaaatcttgaa
aaagaaggtgcattggtttcttataaaaaaaatacagacgggacattaagcccttacgaa
ataaattcttcatacataaatgcagtatcaagaaagaatgatacagatgagatgaaaaca
gggaaatttttaaatgcacaggctgttttacttgcatttaagggtgtacccgcaatatat
gtacatagtatactcggttccgagaattactatgagggtgtaaaaattactggaatgaac
cgtacaataaacagggaaaagctggaatacggaaaaattacttcggaactggaaaataaa
aacggaatcagaagcagaatttataaccgtctaaaagaactgataaaagcaagaaagacc
gaaaaatcttttaatcctgatgcggaacaaataattcagaattttggcagtgaggtattt
tcttttatcagaatatctgtggataaagaggaaaaaattctgattatcaataatatttca
gataaagagatcacattgaaaattccttatgaaataaaacgtacagtgatcgctgaaaat
tctctgactgatgaaaatcatatcaggcttgcatcttatggatttacatggctggaaatt
aaataa

DBGET integrated database retrieval system