KEGG   Sebaldella termitidis: Sterm_1715Help
Entry
Sterm_1715        CDS       T01123                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
str  Sebaldella termitidis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Class
Metabolism; Overview; Carbon metabolism [PATH:str01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:str01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:str00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:str00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:str00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:str00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:str00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1825743..1826705
Genome map
AA seq 320 aa AA seqDB search
MKKIGILTSGGDSPGMNTAIRAVTKMAMNYNCEMYGIKRGYKGMLNDEIFKLNPLDVSGI
ADRGGTILLSARLPEFKQPEVRAKAAANLKRHGIEGLVVIGGDGSYRGADLLFREHGIKV
VGIPGTIDNDIAGTDYTIGYDTTLNIILDAVSRIRDTANSHERTYLLEVMGRDCGDLALY
SAMAGGANGVLIPEVNRSIDELAEDIKERRSQRKLSDIIIVAEGVGHVFDIAKELKEKIN
TEIRVTVLGHIQRGGSPTAFDRVLATRMGARAFELLMEGESGIMVGMENNKMVTHAISYA
WENKTNISLDDYNLTHLLSI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcggaattttaacaagcggtggagactcaccgggtatgaacacagcaatc
agagccgttaccaagatggctatgaactataactgtgaaatgtacggtatcaaaagagga
tataagggaatgcttaatgatgaaatatttaagctgaatcctcttgacgtatcaggtata
gcagatagaggagggactattctgctatcggcgagacttccggaatttaagcagcctgaa
gtaagggcaaaggcagctgcaaatttgaaaagacatggaattgaagggttagtagtaata
ggaggagacggttcttatcgtggagctgatcttctttttagagagcacggaataaaggta
gtaggtattccaggaacaatagataacgacatagctggtactgattatacaattggttat
gacacaacactaaatattattttagatgcggtttccagaataagagatactgcaaattca
catgagagaacatacttattagaagtaatggggagagattgcggggatttagcattgtat
tctgcgatggccggaggagctaacggggtattaataccggaagttaacagatcaatagac
gagcttgcagaagatataaaagaaagaagatctcaaagaaaactatcagacattattatc
gtggcagaaggtgtaggtcatgtttttgacatcgccaaagagctgaaagaaaaaataaat
acagagataagagtaactgtattgggtcacatccaaagaggaggttcgccgactgcattt
gacagagtattagctactagaatgggcgcaagggcatttgagcttcttatggaaggtgaa
agcggaataatggtcgggatggagaataacaaaatggtaactcacgctatctcttacgca
tgggaaaataaaactaacatttctttggatgattataacttaactcatcttttatcgata
taa

DBGET integrated database retrieval system