KEGG   Sebaldella termitidis: Sterm_1715Help
Entry
Sterm_1715        CDS       T01123                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
str  Sebaldella termitidis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sterm_1715
   01230 Biosynthesis of amino acids
    Sterm_1715
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sterm_1715
   00030 Pentose phosphate pathway
    Sterm_1715
   00051 Fructose and mannose metabolism
    Sterm_1715
   00052 Galactose metabolism
    Sterm_1715
  Energy metabolism
   00680 Methane metabolism
    Sterm_1715
Enzymes [BR:str01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sterm_1715
Protein phosphatases and associated proteins [BR:str01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Sterm_1715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1825743..1826705
Genome map
AA seq 320 aa AA seqDB search
MKKIGILTSGGDSPGMNTAIRAVTKMAMNYNCEMYGIKRGYKGMLNDEIFKLNPLDVSGI
ADRGGTILLSARLPEFKQPEVRAKAAANLKRHGIEGLVVIGGDGSYRGADLLFREHGIKV
VGIPGTIDNDIAGTDYTIGYDTTLNIILDAVSRIRDTANSHERTYLLEVMGRDCGDLALY
SAMAGGANGVLIPEVNRSIDELAEDIKERRSQRKLSDIIIVAEGVGHVFDIAKELKEKIN
TEIRVTVLGHIQRGGSPTAFDRVLATRMGARAFELLMEGESGIMVGMENNKMVTHAISYA
WENKTNISLDDYNLTHLLSI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcggaattttaacaagcggtggagactcaccgggtatgaacacagcaatc
agagccgttaccaagatggctatgaactataactgtgaaatgtacggtatcaaaagagga
tataagggaatgcttaatgatgaaatatttaagctgaatcctcttgacgtatcaggtata
gcagatagaggagggactattctgctatcggcgagacttccggaatttaagcagcctgaa
gtaagggcaaaggcagctgcaaatttgaaaagacatggaattgaagggttagtagtaata
ggaggagacggttcttatcgtggagctgatcttctttttagagagcacggaataaaggta
gtaggtattccaggaacaatagataacgacatagctggtactgattatacaattggttat
gacacaacactaaatattattttagatgcggtttccagaataagagatactgcaaattca
catgagagaacatacttattagaagtaatggggagagattgcggggatttagcattgtat
tctgcgatggccggaggagctaacggggtattaataccggaagttaacagatcaatagac
gagcttgcagaagatataaaagaaagaagatctcaaagaaaactatcagacattattatc
gtggcagaaggtgtaggtcatgtttttgacatcgccaaagagctgaaagaaaaaataaat
acagagataagagtaactgtattgggtcacatccaaagaggaggttcgccgactgcattt
gacagagtattagctactagaatgggcgcaagggcatttgagcttcttatggaaggtgaa
agcggaataatggtcgggatggagaataacaaaatggtaactcacgctatctcttacgca
tgggaaaataaaactaacatttctttggatgattataacttaactcatcttttatcgata
taa

DBGET integrated database retrieval system