KEGG   Sebaldella termitidis: Sterm_1880Help
Entry
Sterm_1880        CDS       T01123                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3 4.1.2.25)
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
str  Sebaldella termitidis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sterm_1880
Enzymes [BR:str01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Sterm_1880
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     Sterm_1880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2006489..2007319
Genome map
AA seq 276 aa AA seqDB search
MAVKDRIYIKDLEIIAYHGVLKEEKELGQRFFISLEIQTDFREAGKNDDLTKTISYAEVC
DDIEKIFLTAKYNLIEKCAEEIAEFLLEKYSRISELKVKIKKPWAPIRKAIDHVAVEIVR
KRHKAYISLGSNIGDKEKNLNMALEEIKKISGTQIKKVSGFLITKPFGYTEQDDFLNAAA
ELETLLMPEELLKELLAVEQKLGRVREIKWGPRLIDLDILIFDDEVIDEENLTIPHPWMS
ERMFVLEPFAEIAPNVVHPLSRKRIRELKNELEKNI
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
ttggctgtaaaagatagaatatatataaaggatctggaaataatagcatatcacggagta
ttaaaagaagaaaaagagctgggacaaaggttctttatatctcttgagatacagactgac
ttcagggaagccggaaaaaatgatgatctgactaagacaatcagctatgcagaggtatgt
gacgatatagaaaaaatatttctgacagccaagtataaccttatagagaagtgtgcagaa
gaaatagcagagtttttactggaaaaatacagcagaatttctgaattaaaagtaaaaata
aaaaaaccctgggcacctataagaaaagccatagatcatgtagctgtagaaatagtcaga
aaaagacataaagcatatatttctttaggatcaaatataggtgataaggaaaagaacctt
aacatggcactggaagaaataaagaagatttcaggaacacaaattaagaaagtatcagga
tttttgataacaaagcctttcggctatactgaacaggatgattttttgaatgccgcagca
gagctggaaactcttcttatgcctgaggagcttctgaaagagcttcttgctgtggaacaa
aagctgggaagagtcagggaaataaagtggggacctcgtctgattgatctggatatattg
atatttgatgatgaggtaatagatgaggagaatcttacgattcctcatccgtggatgagt
gagagaatgtttgtgctggagccttttgcggaaatagcacctaatgtagttcatccgctc
agccgtaaaaggatcagagaattaaagaatgaacttgagaaaaatatataa

  All links  
No link information was found.   
DBGET integrated database retrieval system