KEGG   Sebaldella termitidis: Sterm_1882Help
Entry
Sterm_1882        CDS       T01123                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
str  Sebaldella termitidis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:str00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2008125..2008949
Genome map
AA seq 274 aa AA seqDB search
MVLKFREKELELGKRTLIMGILNITPDSFSDGGDNFNIQRAVEHALLMIKDGADIIDIGG
ESTRPGSKFVSAEEELKRVVPVIKELSKITDIPISIDTYKAATAEGAILAGADIINDIWG
LQKDPKMAETAAKYNVPVIAMHNNDGHEYSRDIMEELKLFFDKTFEIAENAGIPKENIIL
DPGIGFGKVYEQNIEVLGRLEELTVLGRVLLGTSRKSTLGKILDLPPKERMEGTLATTVI
GIQKGADIVRVHDVLENKRCAMVADAILRKQNIG
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggtattaaaattcagggaaaaagaactggaattaggaaaaagaacattaataatgggg
attctgaatattactcccgattcattctctgacggcggagataattttaatattcaaagg
gcggtagagcatgcactgctgatgataaaagacggtgctgatattatagacataggcgga
gaatctacaagaccgggaagtaaatttgtcagtgcggaagaggagctgaaaagagtggtt
cccgttataaaagagctgtcaaaaataacagacataccaatatcaatagatacatacaag
gcagcaacagcagaaggagcaattcttgcaggggcagatataataaatgatatctgggga
ttgcagaaggatcctaaaatggcggaaacagcagcaaaatataatgtaccagtaatagca
atgcataataacgacgggcatgaatacagcagggacataatggaggagctgaagcttttc
tttgacaaaacttttgagatagcagaaaatgcaggtattcctaaagaaaatataatactc
gatccgggaataggctttggaaaggtttatgagcagaacatagaggtacttggaaggctt
gaagaattaactgtacttggaagagttcttctgggaacttcaagaaaatcaacacttggg
aaaatactggatcttcccccgaaagaaagaatggaagggacacttgccactacagtaata
gggatacaaaagggagcggatatagtgagagttcatgatgttcttgaaaataagagatgt
gcaatggtagcggatgccatattaaggaagcagaacattggataa

DBGET integrated database retrieval system