KEGG   Sebaldella termitidis: Sterm_2059Help
Entry
Sterm_2059        CDS       T01123                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
str  Sebaldella termitidis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:str00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2187138..2188661
Genome map
AA seq 507 aa AA seqDB search
MKNVTEKNYVIALDQGTTSSRAVIFDKDTNIVGIAQREFQQIYPQPGWVEHDPMEIWATQ
RAVLTEVNAKTGIPLDEIAAIGITNQRETVIVWDKETGEPVYNAIVWQCRRTADMCEELK
KRGLEEYVKENTGLIIDAYFSGTKIKWILDNVPWARERADSGQLLCGTVDTWLVWKLTGG
KVHVTDYTNASRTMLFNIKTLEWDDKLLKELGIPKSMLPEVKNSSEIYGETSLGGGGNTT
TVVPIAGISGDQQAALFGQACFVKGDTKSTYGTGCFMLMNIGHEFIRSKNGLLTTIAIGL
DGKVEYAFEGSIFVAGAVVQWLRDEMRLIADSADTEYFAKKVEDNGGVYVVPAFVGLGAP
YWDMYARGGILGLTRGSNANHIIRAALESIAYQTKDLLEAMQDDSGLILTKLKVDGGAVR
NEFLLQFLADIIGETVLKPEITETTALGAAYLAGMAVGFWKDKDDIKKHWKLNKEFKSEL
DREKRNKYYKGWKKAVERVRNWEREDS
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgttactgaaaagaattatgtgatagctttagatcagggaacgacaagttca
agagctgttatttttgataaagatacaaatatagtaggaatagcacaaagggaattccag
cagatataccctcagccgggctgggtcgagcatgatcccatggaaatctgggcaactcag
agagctgtattaacagaggtgaatgctaagaccgggattcctcttgatgaaatagctgca
ataggtataacaaaccagagagaaacagtaatagtatgggataaagaaacaggggaaccg
gtttataatgcgatagtatggcagtgcagaagaactgccgatatgtgtgaggaactgaaa
aaaagaggacttgaggaatatgtaaaagaaaatacaggtttaataatagatgcttatttt
tcaggaacaaaaatcaagtggattcttgataacgttccctgggcaagggaaagggcagac
agcggacagcttctctgcggtacggtagatacgtggcttgtatggaagcttaccggagga
aaggttcatgtgactgattatacaaatgcgtcaagaacgatgcttttcaatataaaaact
ctggaatgggatgataaactgctgaaagagctgggaataccaaaatcaatgctgcctgag
gtaaaaaattccagtgagatatatggcgaaacatctctcggaggcggaggaaatacaaca
acagttgttcctattgccggaatttccggagatcagcaggcagctcttttcggacaggcc
tgttttgtaaaaggtgatacaaagagtacgtacggaacaggatgttttatgctgatgaat
atagggcatgaatttataagatctaaaaatggtctgcttactacaattgcaatcggactt
gacggaaaagtagaatatgcttttgaaggaagtatatttgtggcaggtgcagttgttcag
tggctgagagatgagatgagacttatagctgattcggcagatacagaatatttcgcaaaa
aaggtagaagataacggaggagtatatgtagtaccggcttttgtaggactgggggcacca
tattgggatatgtatgcaagaggcggtatactgggactgacaagaggatcaaatgcaaat
catataatcagagccgctcttgaatcaatagcttaccagacaaaagatcttcttgaggct
atgcaggatgattctggtcttattcttacaaagctcaaggtagacggaggagctgtaaga
aatgagtttcttctgcagtttcttgcggatataataggtgaaacagtattaaagcctgaa
ataacagaaacaacagcattgggagctgcttatcttgccggtatggctgtgggcttctgg
aaagataaagatgatataaagaaacactggaaattaaataaagaatttaaatctgagctg
gacagggaaaaacgcaataaatattacaaaggatggaaaaaagccgtagaaagagtaagg
aactgggaaagagaagacagctga

DBGET integrated database retrieval system