KEGG   Sebaldella termitidis: Sterm_2253Help
Entry
Sterm_2253        CDS       T01123                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
str  Sebaldella termitidis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sterm_2253
   01230 Biosynthesis of amino acids
    Sterm_2253
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sterm_2253
  Energy metabolism
   00680 Methane metabolism
    Sterm_2253
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sterm_2253
Enzymes [BR:str01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Sterm_2253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2380096..2380707)
Genome map
AA seq 203 aa AA seqDB search
MLDILLVRHGQTKWNVEMRLQGTLDSDLTETGIFQAKKLSERLADIEFSKVYASPSGRTM
KTAELVLGNRVSPIVTDERLKEMNFGVLEGKKIETLNERFKGEITIMHEDPEIYNPSEYN
GETYKELISRTSNFLDDIITKEDGKILVVAHGMSLMAIISAINNLEVKDFWSRGLKPNVS
LTMYNYNNGLFGEELFYDTSHYE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttgctggatatactattagttcgacacgggcagacaaaatggaatgtagaaatgagatta
caggggacattagattcagatttgacggaaactgggatttttcaggcaaaaaagctgagt
gaaagattggcagatattgagttttcaaaagtttatgcttctccaagcggaagaacaatg
aaaactgcagaattagtactgggaaacagagtaagccctatagttacggacgaaagatta
aaggaaatgaattttggcgttcttgaaggaaaaaagatagaaacactgaacgaaagattt
aaaggggaaataactattatgcatgaagatccggaaatatataatccttcagaatataac
ggcgagacatataaagagctgatcagcagaacctctaattttttagatgatattatcact
aaggaagatgggaaaatacttgtagtagctcacggaatgtcacttatggcgataatctcc
gcaataaataatctggaagtaaaggatttttggagcagaggtttaaagcccaatgtttct
ttgacaatgtataattataataatggtttattcggtgaagaactgttttatgatacttca
cattatgaataa

DBGET integrated database retrieval system