KEGG   Sebaldella termitidis: Sterm_2253Help
Entry
Sterm_2253        CDS       T01123                                 

Definition
(GenBank) Phosphoglycerate mutase
Organism
str  Sebaldella termitidis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACZ09107
JGI: Sterm_2253
UniProt: D1AKJ1
Position
complement(2380096..2380707)
Genome map
AA seq 203 aa AA seqDB search
MLDILLVRHGQTKWNVEMRLQGTLDSDLTETGIFQAKKLSERLADIEFSKVYASPSGRTM
KTAELVLGNRVSPIVTDERLKEMNFGVLEGKKIETLNERFKGEITIMHEDPEIYNPSEYN
GETYKELISRTSNFLDDIITKEDGKILVVAHGMSLMAIISAINNLEVKDFWSRGLKPNVS
LTMYNYNNGLFGEELFYDTSHYE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttgctggatatactattagttcgacacgggcagacaaaatggaatgtagaaatgagatta
caggggacattagattcagatttgacggaaactgggatttttcaggcaaaaaagctgagt
gaaagattggcagatattgagttttcaaaagtttatgcttctccaagcggaagaacaatg
aaaactgcagaattagtactgggaaacagagtaagccctatagttacggacgaaagatta
aaggaaatgaattttggcgttcttgaaggaaaaaagatagaaacactgaacgaaagattt
aaaggggaaataactattatgcatgaagatccggaaatatataatccttcagaatataac
ggcgagacatataaagagctgatcagcagaacctctaattttttagatgatattatcact
aaggaagatgggaaaatacttgtagtagctcacggaatgtcacttatggcgataatctcc
gcaataaataatctggaagtaaaggatttttggagcagaggtttaaagcccaatgtttct
ttgacaatgtataattataataatggtttattcggtgaagaactgttttatgatacttca
cattatgaataa

DBGET integrated database retrieval system