KEGG   Sebaldella termitidis: Sterm_2253Help
Entry
Sterm_2253        CDS       T01123                                 

Definition
phosphoglycerate mutase
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
str  Sebaldella termitidis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sterm_2253
   01230 Biosynthesis of amino acids
    Sterm_2253
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sterm_2253
  Energy metabolism
   00680 Methane metabolism
    Sterm_2253
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sterm_2253
Enzymes [BR:str01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Sterm_2253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2380096..2380707)
Genome map
AA seq 203 aa AA seqDB search
MLDILLVRHGQTKWNVEMRLQGTLDSDLTETGIFQAKKLSERLADIEFSKVYASPSGRTM
KTAELVLGNRVSPIVTDERLKEMNFGVLEGKKIETLNERFKGEITIMHEDPEIYNPSEYN
GETYKELISRTSNFLDDIITKEDGKILVVAHGMSLMAIISAINNLEVKDFWSRGLKPNVS
LTMYNYNNGLFGEELFYDTSHYE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttgctggatatactattagttcgacacgggcagacaaaatggaatgtagaaatgagatta
caggggacattagattcagatttgacggaaactgggatttttcaggcaaaaaagctgagt
gaaagattggcagatattgagttttcaaaagtttatgcttctccaagcggaagaacaatg
aaaactgcagaattagtactgggaaacagagtaagccctatagttacggacgaaagatta
aaggaaatgaattttggcgttcttgaaggaaaaaagatagaaacactgaacgaaagattt
aaaggggaaataactattatgcatgaagatccggaaatatataatccttcagaatataac
ggcgagacatataaagagctgatcagcagaacctctaattttttagatgatattatcact
aaggaagatgggaaaatacttgtagtagctcacggaatgtcacttatggcgataatctcc
gcaataaataatctggaagtaaaggatttttggagcagaggtttaaagcccaatgtttct
ttgacaatgtataattataataatggtttattcggtgaagaactgttttatgatacttca
cattatgaataa

DBGET integrated database retrieval system