KEGG   Sebaldella termitidis: Sterm_2268Help
Entry
Sterm_2268        CDS       T01123                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
str  Sebaldella termitidis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sterm_2268
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sterm_2268
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sterm_2268
Enzymes [BR:str01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sterm_2268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2394428..2395921
Genome map
AA seq 497 aa AA seqDB search
MNYKSTRNNEKTVNSSYAVLHGLAGDGGLYIPENLPSVDLNYDILKDMSYQETAFYVLKE
FFPDLGDEELKKSINNAYNTDTFNTPEIAPVAKLDQNISLTELFHGRTLAFKDLALSLFP
YLLTASKKAENEKNDILILTATSGDTGKAALEGFRDVPGIKIIVFYPKNGVSPMQEDQMR
KQLGGNVDIVAIEGNFDDAQSAVKDIFSSQEFKNLCQENNTTFSSANSINIGRLFPQIVY
YVTTYVNLRNKGIITENEKFNVVVPTGNFGNILAAFIAKKMGIPIDKLISASNENNVLAD
FFKTGTYNKERPFYTTNSPSMDILLSSNFERYLYYVTGENSSRISELMENLMKNNTLSVT
EDELTEIQKEFYGDFATENETVDSIKKVYSKFSYLMDPHTAVGYAVLEKYLKESGDKTHS
VIISTAHPYKFPYAAASALNLSEKENPYEMLDDLSAVCGINLPKQLEELKTLPLRFSVII
NKNKISDYVRNKITEKK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaattacaaaagtacaagaaataatgaaaaaactgtgaattccagctatgcagtcctt
cacggacttgccggagacggcgggctttatattcccgaaaatcttccttcagttgatctg
aattatgacattctaaaagatatgtcttatcaggagaccgctttttatgttttaaaggaa
ttttttccggatttgggtgatgaggagctgaagaaatcaataaataacgcttataacact
gataccttcaatacgccggaaatagctccggtagctaaacttgatcaaaatataagcctt
acggagctttttcatggaagaacactggcatttaaggatcttgctctttcactgtttcct
tatctgcttacagcttctaaaaaagcagagaatgaaaaaaatgatatacttatacttact
gccacttccggtgatactggaaaagctgctctcgaaggattccgtgatgttcccggcatc
aaaatcattgtattttatcctaaaaacggtgtaagtcctatgcaggaagatcaaatgaga
aaacaactcggcggtaatgtagatattgttgctattgaaggaaattttgatgatgcacag
tctgccgtaaaagatattttttccagtcaggaatttaaaaatttatgtcaggaaaataat
acgactttctcaagtgcaaattctattaacatcgggcgtctttttccacaaatagtttat
tatgttacgacttatgtaaatctcagaaataaaggaattattacagaaaacgaaaaattc
aacgtagtagttcccacaggaaacttcggtaatatattagctgcatttatagcaaaaaag
atgggtatacctatagataagcttatttcagcttcaaatgaaaataatgttcttgctgat
tttttcaaaaccggtacttataataaagaacgtccgttttacactacaaattctccttca
atggatatcctgctttcatctaattttgaaagatacctgtattatgttaccggggaaaat
tcttcacgtatatctgaattaatggaaaatcttatgaaaaataacactctttcagtaact
gaagatgagctgacagaaatacagaaagaattctacggagattttgccactgaaaatgaa
actgtggattctataaaaaaagtttattcaaaattttcttatttaatggatcctcatact
gctgtaggttatgcagttctggaaaaatatctgaaagaaagcggagataagactcattct
gttattatttccactgcacacccgtataaatttccgtatgctgcagcatcagcacttaat
ttatccgaaaaagaaaatccgtatgagatgctggatgatttatcagctgtatgcggaatt
aaccttccaaagcagctggaagaactaaaaactcttccattaagattttctgttattata
aacaaaaataaaatttctgattatgtcagaaataaaataactgaaaaaaaatag

DBGET integrated database retrieval system