KEGG   Sebaldella termitidis: Sterm_2400Help
Entry
Sterm_2400        CDS       T01123                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
str  Sebaldella termitidis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sterm_2400
   00052 Galactose metabolism
    Sterm_2400
   00500 Starch and sucrose metabolism
    Sterm_2400
   00520 Amino sugar and nucleotide sugar metabolism
    Sterm_2400
Enzymes [BR:str01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sterm_2400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2553699..2554589)
Genome map
AA seq 296 aa AA seqDB search
MKKIRKAVIPAAGLGTRVLPATKAQPKEMLVIVDKPALQYLVEELVDSGIEEILIVTGRN
KTSIENHFDYSYELEKTLEETGKQDFLKMVQRISNMANIYYVRQKQPLGLGHAIGCAESF
IGDEPFVVVLGDDIIHNPIYPATKQLVDKHKELGKGNILGVQEVPETEVNKYGIVDPLKK
IDDRTVEVKGFIEKPDINEAPSRLAALGRYVLEPEIFKYLKETKPGKGGEIQLTDAIFKM
KNDGHKLYAYDYEGIRYDTGDKFGMFKATVEMALRHDELKEMVSDYLKKINIDEIK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataagaaaagcagtaattccggcagcaggattaggaacaagagtattgccg
gcgacaaaagcccagcctaaggaaatgctggtaattgtggataaacctgctcttcagtat
ttagtggaagaacttgttgattccggaatagaagaaatattaatagtgactggcagaaat
aagacttcaatagaaaatcattttgattattcatatgaactggaaaaaacactggaagag
acgggaaaacaggattttttaaaaatggttcaaagaatatcaaacatggccaacatctat
tacgttagacaaaaacagcctttaggtctgggacatgcaataggctgtgcagagagcttc
attggagatgagccgtttgtggtggtattaggagatgatattattcacaatcctatttat
ccagctactaaacagctggtggataagcataaggaactgggaaaaggtaatatattaggg
gttcaggaagtgcctgaaacagaagtaaataaatatggtattgttgatcctttgaaaaag
atagatgacagaactgtggaagtaaaaggatttatagaaaaacctgatataaatgaagcg
ccaagcagacttgcagctttgggaagatatgttttggaacctgaaatattcaagtacctg
aaagaaacaaagccgggaaaaggcggggaaattcaattaactgatgctatttttaaaatg
aaaaacgacggtcataaattatatgcgtatgattatgaggggataagatatgataccgga
gataaattcggtatgtttaaagcaactgtagaaatggctttaagacatgatgaattaaaa
gaaatggtttctgattatcttaaaaaaattaatattgacgaaataaaataa

DBGET integrated database retrieval system