KEGG   Sebaldella termitidis: Sterm_2946Help
Entry
Sterm_2946        CDS       T01123                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
str  Sebaldella termitidis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:str00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3086538..3087083)
Genome map
AA seq 181 aa AA seqDB search
MKGKLIVVSGPSGAGKSTVTKIARDKLHIPLTISATTRKPRQDETDGKDYYFLTEEEFMK
RVNNDEFFEWAKVHDNYYGTLKSEVEKKREEGNTVLLEIDVQGGLIVKKKDPSAVLVFFK
APDDKELEGRLRNRGSDSEEIIRKRLENALKEMEYEKEYDYSIINISIDQSYQELSDIIN
H
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggaaactaatagtagtatcaggtccaagcggagcgggtaaatctacagttaca
aaaatagcgagagataaattacatatacctttaacaatatcagcaacgacaagaaaaccc
agacaggacgaaacagacggaaaagattattactttttaacagaagaagaatttatgaaa
agagtaaataatgatgagttttttgaatgggcaaaagttcatgataattattacggtact
ttgaaatctgaagtagaaaagaaaagggaagaaggaaatacagttttgctggagatagat
gtacagggcggtttgatagtaaagaaaaaggatccaagtgctgtattagttttttttaaa
gctcctgatgataaagagctggaaggaaggctgagaaatagaggctctgattctgaggaa
ataataagaaaaagactggaaaatgctctaaaagaaatggaatatgaaaaggaatatgat
tattctattataaatatcagtatagaccagtcatatcaggaattatcagatattattaat
cattag

DBGET integrated database retrieval system