KEGG   Sebaldella termitidis: Sterm_3039Help
Entry
Sterm_3039        CDS       T01123                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
str  Sebaldella termitidis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:str00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:str00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3180124..3181446)
Genome map
AA seq 440 aa AA seqDB search
MKEYFPEIKEIKYEGPESKNVMAFKYYNKDEVIGGKPMREHLKFAMSYWHTLKAQGLDMF
GGDTMDRAWNRYDDALEQAKARADAGFEFMQKIGMDYFCFHDRDIINEAMTLKETNRLLD
EIVDHLEGLMKKTGIKLLWGTTNAFSHPRFLHGGATAPNADVFAYAAAQVKKAMEITKRL
GGENYVLWGGREGYETLLNTKSDLEYDNFARFLQMVVDYKEKIGFEGQLLIEPKPKEPTK
HQYDFDTATVLGFLRKYNLDKHYKMNIEANHATLAGHTFQHELNLARINNVMGSIDANQG
DMLLGWDTDQFPTNIYDAVLAMYEVIKNNGLGKGGLNFDAKVRRGSFEDKDLFLAYIAGM
DTFAKGLTIAYRLYEDKVFEDFQDKRYESYKTGIGKDIVEGKVGFEELAEYVENLAEIKN
TSGRQEMLESILNSYILEAK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatattttccggaaataaaagaaataaagtatgaaggtcctgaatcaaaaaat
gttatggctttcaaatattacaataaagatgaggtaataggcggaaaaccgatgagagaa
catctgaaatttgcaatgagttactggcatacattaaaagcccagggactggatatgttc
ggcggggacacgatggacagagcatggaacagatatgatgacgcattggaacaggcaaaa
gcaagagcagatgcaggttttgaatttatgcagaaaatagggatggattatttctgcttt
catgacagagatattataaatgaagcaatgacattaaaagaaacaaacagacttcttgat
gaaatagtagatcatctagaaggtcttatgaaaaaaacaggaataaaacttttgtgggga
acaacaaatgcttttagtcatcccagatttcttcacggaggagcaactgcaccaaatgca
gacgtatttgcgtatgctgcggcacaggtaaaaaaggcaatggagataacaaaaagatta
ggcggggaaaattatgttctctggggcggaagagagggctacgaaactcttctgaatact
aagtctgatctggaatatgataactttgccagatttctgcagatggtagtggattacaaa
gaaaaaatagggtttgaagggcagctgcttatagaaccgaaaccaaaagaacctacaaag
caccagtatgattttgatactgctacagttcttggttttttgagaaagtataatcttgat
aaacattataaaatgaatatagaagcaaaccacgccactcttgccggacatacattccag
catgaactgaaccttgcaagaataaataatgtaatgggttccatagatgcaaatcaggga
gatatgcttctgggatgggatacagatcagtttcctacaaatatatatgatgctgttctg
gcaatgtatgaagtaataaaaaataacggattgggtaaaggtggactgaattttgacgca
aaagtaagaagaggctcatttgaagacaaggatttatttttagcttatattgcgggtatg
gacacattcgcaaaaggattaacaatagcttacagactttatgaagataaagtttttgag
gattttcaggataaaagatatgaaagttacaaaacagggataggaaaagatatagtagaa
ggtaaagtaggatttgaagaactggcggaatatgtagaaaatcttgctgaaataaaaaat
acttcgggaagacaggaaatgctggaaagtatattgaattcatatatattggaagcaaaa
taa

DBGET integrated database retrieval system