KEGG   Sebaldella termitidis: Sterm_3305Help
Entry
Sterm_3305        CDS       T01123                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
str  Sebaldella termitidis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sterm_3305
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sterm_3305
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sterm_3305
Enzymes [BR:str01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sterm_3305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3478212..3479393
Genome map
AA seq 393 aa AA seqDB search
MNKKSYYGNFGGQFVPETIMNALIDLENEYEKTIDDKKFRDEFQSLLKDFVGRETPLYHA
KNLSEFYGHNIFLKREDLNHTGAHKINNALGQALLAKRMGKKKVIAETGAGQHGVAAATA
AALLGMECDVYMGAVDIERQRLNVFRMELLGARVISVEEGLKTLKEATTAAIQAWVNEVE
DVFYIIGSVVGPYPYPKMVKDFQSVIGDETKKQMEKYGNTDCIIACVGGGSNAMGIFSAF
LDNEDTALYGIEAGGKGIDTEEHAATLSMGSPGILHGMKTYVLQDKYGRINPVHSISAGL
DYPGVGPEHSYLFDTKRVTYAAVTDDEAIEALLLLTQKEGIIPAIESAHAVAYLKKLCPV
LKEKKNIVVNISGRGDKDMHTVFSILKGGEIHE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaatcttattatggaaatttcgggggacagtttgttcctgaaactattatg
aatgcactgattgatcttgaaaatgaatatgaaaaaaccattgatgataaaaaattcaga
gacgaatttcaaagtctgctgaaagacttcgtaggaagagaaactcctttataccacgca
aaaaatctgagtgaattttacgggcataatatatttttaaaaagagaagatctgaaccac
acaggagctcataaaataaataatgcacttggtcaggctcttcttgccaaaagaatgggt
aaaaagaaagtaattgctgaaacaggtgcaggacagcacggtgttgccgcagctactgcc
gctgctcttctgggtatggaatgtgatgtatatatgggagctgtagatatcgaaagacaa
aggctgaatgtttttcgtatggaactcctcggagccagagtcatttcagtggaggaaggg
ctgaaaaccctgaaagaggctactaccgctgctattcaggcatgggtcaatgaagtagag
gatgtattttatattattggttccgtagtaggaccatatccatatccaaaaatggtaaaa
gattttcagtctgtcatcggtgatgagacaaaaaaacaaatggagaaatatggaaatact
gactgtattattgcctgtgtgggcggcggcagtaatgccatgggtattttttccgctttt
cttgataatgaagatacggcattgtacggtattgaagccggaggaaaaggaattgacaca
gaagagcatgcagctacccttagtatgggaagtccgggaatactccacggtatgaaaact
tatgttcttcaggataaatacgggcggataaatcctgttcactctatatcagcagggctt
gattatcccggagtcggtcccgaacactcttatctttttgatactaaaagagtaacatat
gcggcggttactgatgatgaagctatagaagcacttctgctgctcacacaaaaagaagga
ataattcccgctatagaaagtgcacatgcagtggcctatctaaaaaaactatgccctgta
ttaaaagaaaagaaaaacattgttgtaaatatttcaggacgcggagataaagatatgcat
acagtattttcaatattaaaaggaggagaaatccatgaataa

DBGET integrated database retrieval system