KEGG   Sebaldella termitidis: Sterm_3306Help
Entry
Sterm_3306        CDS       T01123                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
str  Sebaldella termitidis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sterm_3306
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sterm_3306
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sterm_3306
Enzymes [BR:str01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sterm_3306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3479386..3480144
Genome map
AA seq 252 aa AA seqDB search
MNKLQNIFKDKKNVNIGYIVGGFPNIDYTRKFLLNLKKSPIDILEIGIPYSDPIADGKII
SEASFKASQNNITPDTVFDLLISEKENIHTPLVFLIYYNLIFAYGIDHFIKKSVEAGITG
LVIPDLPYEEAQELIEKLNKNNIAFIPLISVTSQNRIPKLVSQGSGFIYAIASLGVTGTK
QVSPDRLTEFIHEIKKYTDLPVAIGFGIKNREDIIKLRNSADGLIVGTSIVRLTESYTPD
EVVPKLEELFVV
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaataagctgcaaaatatttttaaagacaagaaaaatgtaaatatcggatatatagta
ggcggttttccaaatattgattataccagaaagtttcttctgaatctgaaaaaatcacct
atagatattctggaaataggtattccctattccgatcccatagctgacggaaaaataatt
tcagaagcttcctttaaagcttcacagaataatattactcctgacacagtttttgacctt
ttaatttctgaaaaggaaaatatacatactccccttgtgtttttaatttattataatctt
atttttgcttacggaattgatcattttataaaaaaatccgtagaagcaggcataacagga
cttgtaattcctgatctgccgtatgaagaggcacaggagcttattgagaagcttaataaa
aataatattgcctttattcctcttataagcgttacttcacaaaaccggattccaaaactg
gtttcacagggaagcggttttatatatgctattgcatcacttggcgttactggaacaaaa
caggtttctccggacagacttactgaatttatacacgagataaaaaagtatactgatctt
cctgttgctataggctttggaataaaaaacagggaagatataataaagctgcgtaactcg
gcagacggtctgatagtgggaacctctatagtccggctgacagaaagctatactcctgat
gaggtagttcccaagctggaggagttattcgttgtatag

DBGET integrated database retrieval system