KEGG   Sebaldella termitidis: Sterm_3550Help
Entry
Sterm_3550        CDS       T01123                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
str  Sebaldella termitidis
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:str00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3764392..3765036)
Genome map
AA seq 214 aa AA seqDB search
MILQKERELIVEYGKKLITHGLTKGTGGNISIYNKEEGLMAISPSGIDYFETKPENVAVL
DLYGKQVDGDKKPSSEYFMHRVFYRDRDDVGAVVHAHSTYSGVLATLHWEIEPVHYLIGY
AGKNVRCAPYELFGTEELAQAALKAMEDRNACLLANHGLLAIGGTVEYAFDTAEETEFVA
ELYYKAKCVGEPIPLKSEEMDEFLEKFKPYGKKL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgattttacaaaaagaaagagaacttatagtggaatacggaaaaaaactgataacacac
ggtctgactaaaggaacaggggggaatataagtatttataataaggaagaggggctgatg
gcaataagtcccagcggaatagattattttgagacaaagccggaaaatgtggcagtactt
gatttatacggaaaacaggtagacggggataaaaagccttcaagcgagtattttatgcac
agggtattttacagagacagagatgatgtaggagcagtggtacatgcacattcgacatat
tcaggagtgctggcaacactgcactgggaaatagagcctgttcattatctgataggatat
gcagggaaaaatgtaagatgtgcgccttatgaattatttggtacagaggagcttgcacag
gcggcgcttaaagcaatggaagacagaaacgcttgtcttcttgccaatcacggactgctt
gcaataggcggaacagtggagtatgcttttgatacagcggaagaaacagaatttgtggcg
gaattatactataaagcaaaatgtgtgggagagccgattccgctgaaatcagaggaaatg
gacgaatttcttgagaagtttaagccttacgggaaaaaattataa

DBGET integrated database retrieval system