KEGG   Sebaldella termitidis: Sterm_3674Help
Entry
Sterm_3674        CDS       T01123                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
str  Sebaldella termitidis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:str00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sterm_3674
Enzymes [BR:str01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Sterm_3674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3900587..3901204)
Genome map
AA seq 205 aa AA seqDB search
MFEYIRGELTVKKIDYVALEVNGIAYKIFISLKTYDMLTEDTEKLFIYTNVKEDDFSLYG
FKTESERELFKALVSISGVGPKLGLAILSTFNTQEVIDIVIEENAKLLVRVPGLGQKKAQ
KLIVDLKDKVKKLNVIGIAQDGSHDTASSVSSTKALIMKEDLKLALESLGYSNADVSKWI
KDEEIEKYERVEDAIRDILKKIQSK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatatataagaggagaactcacggtaaaaaagatagattatgtggctcttgaa
gtaaacggtattgcatacaaaatattcatctcactaaaaacctatgatatgcttacagag
gatactgaaaaattatttatttacactaatgtaaaggaagatgatttttcattatacgga
tttaagactgaaagtgaaagagagctgttcaaagcattggtaagtataagcggagtaggg
cctaagctcgggctggcgatactttccacatttaatacacaagaagtgatcgacatagta
atagaggaaaatgccaagcttcttgtaagggtaccgggattagggcagaaaaaagcccaa
aagctgattgtggatctgaaagataaggtaaagaagctcaatgtaatcgggattgcacag
gatggaagccacgatacagcgagcagcgtatccagcacaaaggcacttattatgaaggaa
gacttaaagcttgcgcttgaatctctcggttattccaatgctgatgtatcaaagtggata
aaagatgaggaaatagagaaatatgagcgtgtagaagatgcgataagagatattttaaaa
aaaatacaatcaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system