KEGG   Sebaldella termitidis: Sterm_3770Help
Entry
Sterm_3770        CDS       T01123                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
str  Sebaldella termitidis
Pathway
str00010  Glycolysis / Gluconeogenesis
str00020  Citrate cycle (TCA cycle)
str00620  Pyruvate metabolism
str01100  Metabolic pathways
str01110  Biosynthesis of secondary metabolites
str01120  Microbial metabolism in diverse environments
str01130  Biosynthesis of antibiotics
str01200  Carbon metabolism
Module
str_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sterm_3770
   00020 Citrate cycle (TCA cycle)
    Sterm_3770
   00620 Pyruvate metabolism
    Sterm_3770
Enzymes [BR:str01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sterm_3770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: ACZ10604
JGI: Sterm_3770
UniProt: D1AIV3
Position
complement(4008350..4009678)
Genome map
AA seq 442 aa AA seqDB search
MSVEIIMPKAGMSMEEGTIVKWLKSEGDEIKEGEPIVEILTDKVNMEVEAESSGFLIKKV
RFEDEVLPVFTVIGYIGEKGETVSEREEKAKTAEVIKDEKKPDKKETEENSVFFNKSLMQ
SDKLNRATPAARKKARDNNLNLGDIPGSGPKGRVQLADVESFAAGSTVKATPLARKIAGQ
EGIDLDGISGTGAKGKIFKRDLVLNAAPEIISKEAELKPYSGIRKVIGDRMTESQFSAPT
FTLNIEVGVNKLLKLKDKIAAPLMDETGEKLTINDLLILAVSRGVRKYPDINVSLTDKGI
LCHKEINVGFAVSGNGVLMVPVVKNTEDKGIRNILTEGKDLIKKAREGKLGAAEQSGSTI
TLSNLGMYGVHYFNPIINQPNSCIIGVGTIEEKPVAKAGKISVKKVIYLSATFDHRVIDG
ALGAEFMQYVKKLIEDPYSLLI
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtagagataataatgccaaaggcaggaatgtcaatggaagaaggaacaatagta
aaatggctgaaaagtgaaggagatgaaataaaagaaggggagcctatagtagaaatatta
acagataaggttaatatggaagtagaggctgaaagctcaggttttctgataaaaaaagta
agatttgaagatgaagtgctgccggtatttacagtaataggatatataggtgagaaaggt
gaaaccgtaagtgaaagagaagaaaaagccaaaacagcggaagtaatcaaggatgaaaag
aaacctgacaaaaaggaaacagaagaaaactctgtcttctttaataaatctcttatgcag
tcagataaactaaacagggcaacaccagcagcaagaaagaaagcaagagataataatctg
aacctcggggatataccaggctcaggaccgaaaggaagagtccagcttgcagatgtggaa
agcttcgcagcaggaagtacagtaaaggctactcctcttgcaagaaaaatagcaggacag
gaaggaatagacctggacggtataagcggaacaggagcaaaaggaaagatattcaaaaga
gatcttgttcttaatgcagctccggaaataatatcaaaagaagcagagctgaaaccatat
tcaggaataagaaaagtaataggggacagaatgacagaaagtcagttctcagcaccgaca
tttacacttaatatagaagtaggagtaaataaattactaaaactgaaagataaaatagcc
gcaccgctgatggatgaaacaggagaaaagctgacaataaatgatcttcttattctggca
gtaagcagaggagtaagaaaatacccggatataaatgtatcattaacagataaaggaatc
ctttgtcataaagagataaatgtaggctttgcagtatcagggaacggggtattaatggtg
cctgtagtaaagaatacagaagataaaggaataagaaatatacttacagaaggaaaagat
ctgatcaaaaaagcaagagaaggaaaactgggagcagcagaacagagcggaagtacaata
acattaagcaatcttggaatgtatggagttcattactttaatccgataataaaccagcca
aacagctgtataataggagtaggaacaatagaagaaaagcctgtggcaaaagcaggaaaa
atatcagtaaagaaagtaatttaccttagtgcaacatttgatcacagagtaatagacgga
gcacttggagcagagtttatgcagtatgtaaagaaattaatagaagacccttatagtctg
ttaatataa

DBGET integrated database retrieval system