KEGG   Streptomyces sp. PAMC26508: F750_0166Help
Entry
F750_0166         CDS       T02619                                 

Definition
secreted endo-1,4-beta-xylanase B (xylanase B)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
strp  Streptomyces sp. PAMC26508
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
157383..158108
Genome map
AA seq 241 aa AA seqDB search
MQQDGTQQDRTRQNPAQFGGMSRRRFIGGAGTAALATASGLLLPGTAHAATTITTSQTGN
DGMYYSFWTDGGGSVSMTLNGGGSYSTRWTNCGNFVAGKGWNTGGRRSVRYNGYFNPSGN
GYGCLYGWTSNPLVEYYIVDNWGNYRPTGEYRGTVSSDGGTYDIYKTTRYNAPSVEGTRT
FDQYWSVRQSKVTSGSGTITTGNHFDAWARAGMNMGQFRYYMIMATEGYQSSGSSNITVS
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggacggaacgcagcaggaccggaccaggcagaacccagctcagttcggcggc
atgagccggcgacgcttcatcggcggcgccggtacggccgcgctcgctacggcgtccggg
ctgctgctgcccggcaccgcccatgccgccaccaccatcaccacgagccagaccggcaac
gacggcatgtactactcgttctggaccgacggcggaggctccgtctccatgacgctgaac
ggcggcggcagctacagcacccggtggaccaactgcggcaacttcgtcgcaggcaagggc
tggaacaccggcgggcgcaggtccgtccggtacaacggctatttcaacccgtcgggtaac
ggatacggctgcctctacggctggacgtcgaacccgctggtggagtactacatcgtcgac
aactggggcaactatcggcccaccggcgagtacaggggcaccgtctccagtgacggaggc
acgtacgacatctacaagacgacgcggtacaacgccccctccgtcgagggcacccgcacc
ttcgatcagtactggagcgtccggcagtccaaggtgaccagtggctccggcaccatcacc
accggcaaccacttcgacgcctgggcgcgcgcgggcatgaatatgggccagttcaggtac
tacatgatcatggccaccgagggctatcagagcagcgggagttcgaacatcacggtcagc
ggctga

DBGET integrated database retrieval system