KEGG   Streptomyces sp. PAMC26508: F750_0166Help
Entry
F750_0166         CDS       T02619                                 

Definition
secreted endo-1,4-beta-xylanase B (xylanase B)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
strp  Streptomyces sp. PAMC26508
Brite
Enzymes [BR:strp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     F750_0166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
157383..158108
Genome map
AA seq 241 aa AA seqDB search
MQQDGTQQDRTRQNPAQFGGMSRRRFIGGAGTAALATASGLLLPGTAHAATTITTSQTGN
DGMYYSFWTDGGGSVSMTLNGGGSYSTRWTNCGNFVAGKGWNTGGRRSVRYNGYFNPSGN
GYGCLYGWTSNPLVEYYIVDNWGNYRPTGEYRGTVSSDGGTYDIYKTTRYNAPSVEGTRT
FDQYWSVRQSKVTSGSGTITTGNHFDAWARAGMNMGQFRYYMIMATEGYQSSGSSNITVS
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggacggaacgcagcaggaccggaccaggcagaacccagctcagttcggcggc
atgagccggcgacgcttcatcggcggcgccggtacggccgcgctcgctacggcgtccggg
ctgctgctgcccggcaccgcccatgccgccaccaccatcaccacgagccagaccggcaac
gacggcatgtactactcgttctggaccgacggcggaggctccgtctccatgacgctgaac
ggcggcggcagctacagcacccggtggaccaactgcggcaacttcgtcgcaggcaagggc
tggaacaccggcgggcgcaggtccgtccggtacaacggctatttcaacccgtcgggtaac
ggatacggctgcctctacggctggacgtcgaacccgctggtggagtactacatcgtcgac
aactggggcaactatcggcccaccggcgagtacaggggcaccgtctccagtgacggaggc
acgtacgacatctacaagacgacgcggtacaacgccccctccgtcgagggcacccgcacc
ttcgatcagtactggagcgtccggcagtccaaggtgaccagtggctccggcaccatcacc
accggcaaccacttcgacgcctgggcgcgcgcgggcatgaatatgggccagttcaggtac
tacatgatcatggccaccgagggctatcagagcagcgggagttcgaacatcacggtcagc
ggctga

DBGET integrated database retrieval system