KEGG   Streptomyces sp. PAMC26508: F750_0875Help
Entry
F750_0875         CDS       T02619                                 

Gene name
ligD
Definition
ATP-dependent DNA ligase clustered with Ku protein (EC:6.5.1.1)
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
strp  Streptomyces sp. PAMC26508
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:strp00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    F750_0875 (ligD)
   03420 Nucleotide excision repair
    F750_0875 (ligD)
   03430 Mismatch repair
    F750_0875 (ligD)
   03450 Non-homologous end-joining
    F750_0875 (ligD)
Enzymes [BR:strp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     F750_0875 (ligD)
DNA repair and recombination proteins [BR:strp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      F750_0875 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
875924..876478
Genome map
AA seq 184 aa AA seqDB search
MDSESTRRFVVQIHDARRMHFDFRLEVDGVLKSWAVPRGPSDNPSDKRLAVPTEDHPLEY
REFEGVIPRNEQGSGTVIVWDQGTYRPTSHDLAGAPVPFAESLETGHATFWLDGAKLHGE
FALTRFHIDDEDGTRGPEAWLLIKANDRQAVHDRPGTPDPYHARSARTGRTLHQVAVAER
EGAG
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtggacagcgagagcacacggcgtttcgtggtgcagatccacgacgcccggcgcatgcat
ttcgacttccggctcgaggtggacggtgtcctgaagtcctgggcggtaccgcgtggcccg
tcggacaaccccagcgacaaacggctggccgtgccgacggaggatcatcctctggagtac
cgcgagttcgagggagtcatcccgcgaaacgagcagggcagcgggaccgtgatcgtgtgg
gaccagggcacctaccgcccgaccagccacgacctcgcgggcgcccccgtcccgttcgcc
gagtccctggagacaggacacgcgacgttctggctcgacggggcgaaactgcacggcgaa
ttcgccctcacccgtttccacatcgacgacgaggacgggacgcgcggcccggaggcctgg
ctcctgatcaaggcgaacgaccgccaggccgtccacgatcgcccgggaacacccgatccg
taccatgcccgctcggcccgcaccggccgcacgctgcaccaggtcgccgtggcggagcgg
gagggcgcgggctga

DBGET integrated database retrieval system