KEGG   Streptomyces sp. PAMC26508: F750_0875Help
Entry
F750_0875         CDS       T02619                                 

Gene name
ligD
Definition
(RefSeq) ATP-dependent DNA ligase clustered with Ku protein (EC:6.5.1.1)
Organism
strp  Streptomyces sp. PAMC26508
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
875924..876478
Genome map
AA seq 184 aa AA seqDB search
MDSESTRRFVVQIHDARRMHFDFRLEVDGVLKSWAVPRGPSDNPSDKRLAVPTEDHPLEY
REFEGVIPRNEQGSGTVIVWDQGTYRPTSHDLAGAPVPFAESLETGHATFWLDGAKLHGE
FALTRFHIDDEDGTRGPEAWLLIKANDRQAVHDRPGTPDPYHARSARTGRTLHQVAVAER
EGAG
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtggacagcgagagcacacggcgtttcgtggtgcagatccacgacgcccggcgcatgcat
ttcgacttccggctcgaggtggacggtgtcctgaagtcctgggcggtaccgcgtggcccg
tcggacaaccccagcgacaaacggctggccgtgccgacggaggatcatcctctggagtac
cgcgagttcgagggagtcatcccgcgaaacgagcagggcagcgggaccgtgatcgtgtgg
gaccagggcacctaccgcccgaccagccacgacctcgcgggcgcccccgtcccgttcgcc
gagtccctggagacaggacacgcgacgttctggctcgacggggcgaaactgcacggcgaa
ttcgccctcacccgtttccacatcgacgacgaggacgggacgcgcggcccggaggcctgg
ctcctgatcaaggcgaacgaccgccaggccgtccacgatcgcccgggaacacccgatccg
taccatgcccgctcggcccgcaccggccgcacgctgcaccaggtcgccgtggcggagcgg
gagggcgcgggctga

DBGET integrated database retrieval system