KEGG   Streptomyces sp. PAMC 26508: F750_1824Help
Entry
F750_1824         CDS       T02619                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
strp  Streptomyces sp. PAMC 26508
Pathway
strp00220  Arginine biosynthesis
strp00250  Alanine, aspartate and glutamate metabolism
strp00290  Valine, leucine and isoleucine biosynthesis
strp01100  Metabolic pathways
strp01110  Biosynthesis of secondary metabolites
strp01130  Biosynthesis of antibiotics
strp01210  2-Oxocarboxylic acid metabolism
strp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:strp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    F750_1824
   00290 Valine, leucine and isoleucine biosynthesis
    F750_1824
   00220 Arginine biosynthesis
    F750_1824
Enzymes [BR:strp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     F750_1824
    2.6.1.66  valine---pyruvate transaminase
     F750_1824
Amino acid related enzymes [BR:strp01007]
 Aminotransferase (transaminase)
  Class I
   F750_1824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Alliinase_C
Motif
Other DBs
NCBI-ProteinID: AGJ54320
UniProt: M9TTS5
Position
1871276..1872487
Genome map
AA seq 403 aa AA seqDB search
MEFRQSSKLNEVCYEIRGPVIEQANALEEAGHSVLRLNTGNPALFGFEAPEEIVQDMIRM
LPQAHGYTDSRGILSARRAVAQRYQAMGMADVDVDDIFLGNGVSELISMAVQALLEDGDE
ILIPSPDYPLWTAVTTLAGGKAVHYTCDEGADWNPDLADMASKITDRTRAMVIINPNNPT
GAVYSRDVLDGMLDLARRHGLMVFADEIYDQILYDDAEHHSVAVLAPDLLCLTFSGLSKT
YRVAGFRSGWMVVSGPRQHARSYLEGLTMLASMRLCPNAPAQYAIQAALGGRQSIRDLVA
PGGRLHEQRDRAWERLNEIPGVSCVKPKGALYAFPRIDPKVHAIVDDERFVLDLLLREKI
QVVQGTGFNWPRPDHFRILTLPHADDLDAAISRIGRFLNGYRQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggagttccggcagtccagcaagctcaacgaggtctgttacgagatccggggtccggtc
atcgagcaggccaacgccctggaggaggcggggcacagcgtgctccgcctcaacacgggc
aatccggcgctcttcggcttcgaggcgcccgaggagatcgtgcaggacatgatccggatg
cttccccaggcgcacggctacaccgactcgcgcggcatcctgtccgcccggcgcgccgtc
gcgcagcgctaccaggcgatggggatggccgatgtcgacgtggacgacatcttcctcggc
aacggggtctccgagctgatctccatggccgtccaggcactcctggaggacggcgacgag
atcctgatcccgagccccgactatccgctgtggaccgccgtcacgacgctcgcgggcggg
aaggccgtgcactacacgtgcgacgagggcgcggactggaaccccgacctcgccgacatg
gcctcgaagatcaccgaccgcacccgggccatggtcatcatcaacccgaacaacccgacg
ggcgcggtctactcccgcgacgtcctcgacggcatgctcgacctggcgcgcaggcacggg
ctcatggtgttcgccgacgagatctacgaccagatcctgtacgacgacgccgagcaccac
agcgtggcagtactggctcccgacctcctctgcctcaccttcagcggtctgtcgaagacg
taccgcgtcgcgggattccgttcgggctggatggtggtgtcgggtccgcggcagcacgcc
cgcagctatctggaggggctcaccatgctcgcctccatgcggctgtgccccaacgccccg
gcgcagtacgcgatccaggcggccctcggcggccgtcagtcgatccgggacctggtggcc
ccgggaggcaggctccacgagcagcgcgaccgggcctgggagcggctcaacgagattccc
ggggtgtcgtgcgtgaagcccaagggcgcgctgtacgccttcccgcgcatcgacccgaag
gtccacgccatcgtcgacgacgaacgcttcgtgctggacctgctgcttcgggagaagatc
caggtggtgcagggcaccgggttcaactggccgcgcccggaccacttccgcatcctcacc
ctcccgcacgccgacgatctggacgccgctatcagccgtatcggccgcttcctgaacgga
taccgccagtga

DBGET integrated database retrieval system