KEGG   Streptomyces sp. PAMC26508: F750_1884Help
Entry
F750_1884         CDS       T02619                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
strp  Streptomyces sp. PAMC26508
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:strp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    F750_1884
Enzymes [BR:strp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     F750_1884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1940463..1941347
Genome map
AA seq 294 aa AA seqDB search
MTAIAVLGSTNMDLVAYVARAPGRGETVTGREFRTVPGGKGANQAVAAARAGGEVVMIGA
VGTDEYGSALRTHLEHAGVDTDLLHTVAGPSGTAHIVVDDEGANSIVVIPGANGSVTALG
PGERAAVSAAGLLLLQLELPLTAVTEAARTARDRGVRTILTPSPVRTLPSALLAAVDLLI
PDEHEATALTGCAEPDAAAQILLRQVPAVVITLGRKGCLYAARGAEPVLFPAPEVTAVDT
TGAGDTFVGTLAVALGEGRPVPEAVAWASSAAALCVQRQGASTSMPHRSEIDAA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgatcgcggtgctcggcagcaccaacatggacctggtcgcctacgtcgcccgg
gcacccgggcgcggggagaccgtcaccggacgggagttccggaccgtccccggaggcaag
ggggccaaccaggccgtcgccgcggcccgcgcgggaggcgaggtggtgatgatcggcgcg
gtcgggaccgacgagtacggctcggccctccgcacgcatctggagcacgccggagtggac
accgacctgctgcacaccgtcgcggggcccagcggcaccgcgcacatcgtcgtcgacgac
gagggggccaactccatcgtggtgatcccgggcgccaacggcagcgtgaccgcgctcggc
cccggcgagagggcggccgtctcggcggcgggcctgctgctcctgcagctggaacttccg
ctgaccgccgtgaccgaggcggcccggaccgcgagggaccgcggcgtacggacgatcctc
accccctcccccgtgcggacgctgccgtccgcgctgctggccgccgtcgacctgctgatc
cccgacgagcacgaggccaccgcgctcaccggctgcgcggaaccggacgccgcggcgcag
atcctgctccgccaggtacccgcggtcgtgatcacactcggccgcaagggctgcctctac
gcggcccggggcgccgaaccggtcctcttcccggcccccgaggtcaccgccgtcgacacg
accggcgccggcgacaccttcgtcggcacgctcgccgtggcgctcggcgagggccggccg
gtgcccgaggcggtggcctgggcgtcgtccgccgccgcgctctgcgtacagaggcagggt
gcctcgacgtccatgccccaccgcagcgagatcgatgccgcatga

DBGET integrated database retrieval system