KEGG   Streptomyces sp. PAMC26508: F750_1929Help
Entry
F750_1929         CDS       T02619                                 

Definition
putative secreted alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
strp  Streptomyces sp. PAMC26508
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:strp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    F750_1929
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    F750_1929
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    F750_1929
Enzymes [BR:strp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     F750_1929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1988483..1990138
Genome map
AA seq 551 aa AA seqDB search
MTSRQFSTAPTRRTVVKAAAATAVAGSVLAAATSARAAGGPAFLHGVASGDPLPDGILLW
TRVTPAPDAVPGSGLGADTPVVWEIAEDKAFSRVAARGTAVARAGSDHTVKADVRGLRPA
TAYFFRFSVADGKEGVLSPVGRTRTAPAAGTSVPGIRFGVVSCANWEAGWFSPYRHLAAR
ADLDAVLHLGDYIYEYASGSYPTQDTVVRPHAPLHEIVSLADYRLRHATYKTDTDLQALH
AAHPVIAIWDDHEFANDAWSGGAENHTPGTEGPWTARMAAAKQAYFEWMPVRASTEGTVY
RRLRFGDLAELHLLDLRSFRSEQASVGNGAVDDPERSITGRAQLDWLKAGLTASDARWKL
VGTSVMISPVAFGALPAHLLAPLAELLGLPAEGLAVNVDQWDGYTDDRKELISHLRDHAV
TDTVFLTGDIHMAWANDVPVKAATYPLSASAATEFVVTSVTSDNLDDILRVAPRTVSVVA
ATAVKAANRHVKWVDLDSHGYGVLDVTAERSQMDYYAVSDKTDKGAASSWVRSYRTLSGT
QRVERVGAPVR
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagtcgacagttctccaccgcgcccacccgccgcacggtcgtcaaggccgccgcc
gccaccgcggtcgccggctccgtgctcgccgccgccacgagcgcccgcgcagccggcggc
cccgccttcctgcacggcgtcgcctccggcgacccgctgcccgacggcatcctcctgtgg
acccgcgtcacccccgcgccggacgccgtaccgggctcggggctgggcgcggacaccccg
gtggtctgggagatcgccgaggacaaggccttctcccgcgtcgcggcccggggcacggcc
gtcgcgcgggccggctccgaccacacggtcaaggccgacgtccgggggctgcgcccggcc
acggcgtacttcttccgcttctccgtggccgacggcaaggagggtgtcctctcccccgtc
ggccgtacccgcacggcgcccgctgccgggacctcggtcccgggaatccgtttcggcgtg
gtgtcctgcgccaactgggaggccggctggttctccccgtaccgccatctcgcggcacgt
gccgacctggacgccgtcctgcacctgggtgactacatctacgagtacgcgtcgggcagt
tacccgacccaggacaccgtcgtccgcccgcacgccccgctgcacgagatcgtctccctc
gccgactaccggctgcggcacgccacgtacaagacggacaccgacctccaggcgctgcac
gccgcccatccggtgatagccatctgggacgaccacgagttcgccaacgacgcctggtcg
ggcggggccgagaaccacaccccgggcaccgagggcccgtggacggcccggatggccgcc
gcgaagcaggcgtacttcgagtggatgccggtccgcgcctccacggagggcaccgtctac
cgacgcctgcgcttcggcgacctggccgaactgcacctgctcgacctgcgcagcttccgc
tccgagcaggcgtccgtcggcaacggagcggtcgacgacccggagcgctcgatcacgggg
cgtgcgcaactggactggctgaaggcgggactgacggcgtcggacgcccgctggaagctg
gtcggcacctcggtgatgatctcgccggtcgccttcggggcgttgccggcccatctgctg
gcgccgctcgccgagctgctggggctgccggcggaagggctcgctgtcaacgtcgaccag
tgggacggctacacggacgaccgcaaggagctgatctcccatctgcgggaccacgccgtg
accgacacggtcttcctgaccggcgacatccacatggcgtgggccaacgacgtacccgtc
aaggcggcgacgtatcccctgtcggcgtccgccgccaccgagttcgtggtcacctcggtc
acctcggacaatctggacgacatcctgcgggtggccccccggacggtgtccgtcgtcgcg
gcgacggcggtcaaggcggcgaaccgccacgtgaagtgggtcgatctcgactcgcacggc
tacggcgtcctcgacgtgacggccgagcgctcgcagatggactactacgccgtctccgac
aagacggacaagggagcggcgtcgtcctgggtccgctcctaccgcacgctcagcggcacc
cagcgggtcgagcgggtcggcgccccggtgcgctga

DBGET integrated database retrieval system