KEGG   Streptomyces sp. PAMC26508: F750_1987Help
Entry
F750_1987         CDS       T02619                                 

Definition
putative esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
strp  Streptomyces sp. PAMC26508
Brite
Enzymes [BR:strp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     F750_1987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2052958..2053737
Genome map
AA seq 259 aa AA seqDB search
MPVLPGAEPFRHEGGEVGVLLCHGFTGSPQSLRPWADHLAERGLTVSLPLLPGHGTRWED
MAVTGWQDWYAEVDRELRALTARCEQVFVFGLSMGGALALRLAAKHGDEIAGLVLVNPAN
KVHGLSAYALPVARHVVRTTKGLTSDIALAGAEEVGYDRVPLHAAHSVRAFFRLVDADLP
QVTQPVVLLHSPQDHVVPPADSARILSRISSTDVEEILLEQSYHVATLDHDAERIFDESY
RFIDRLATDAGRKGSTSGG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgccggtcctccctggagccgagccgttccgccacgagggcggagaggtcggcgtcctc
ctctgtcacgggttcacgggctcgccgcagtccctgcgcccctgggccgaccacttggcg
gagcgcggactgaccgtgtccctcccgctgctgcccggacacggcacgcgctgggaggac
atggcggtcacgggctggcaggactggtacgccgaggtggaccgggagctgcgggccctg
acggcgcggtgcgagcaggtcttcgtcttcggcctgtccatgggaggggcgctggcgctg
cgcctcgccgcgaagcacggtgacgagatcgcgggcctggtgctggtgaatccggcgaac
aaggtgcacggcctctccgcctacgccctgccggtcgcccggcacgtggtgcgtacgacg
aaggggctgaccagcgacatcgcgctggcgggtgccgaggaggtcgggtacgaccgggtg
ccgctgcacgccgcacactccgtgcgggcgttcttccggctggtcgacgccgatctgccc
caggtcacccagccggtggtactgctgcacagcccgcaggaccacgtcgtgccgccggcc
gactcggcacggatcctcagccggatctcgtcgacggatgtcgaggagatcctcctggaa
cagagctaccacgtggcgacgttggaccacgatgcggagcggatcttcgatgagagctac
cggttcatcgaccgcctcgcgaccgacgccggaagaaaggggagcacgtccggtggctga

DBGET integrated database retrieval system