KEGG   Streptomyces sp. PAMC26508: F750_2482Help
Entry
F750_2482         CDS       T02619                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
strp  Streptomyces sp. PAMC26508
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    F750_2482
Enzymes [BR:strp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     F750_2482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2573473..2575620)
Genome map
AA seq 715 aa AA seqDB search
MGLSRLAALHGVATSFSPSADVTVPVPDDTVTAVLAALGVDADTPADVRRSLAAAESAAA
SRLLPPTVVAWSGEPLPAALAALPAGALLTVDPEPGTTGAPRPLRMRVLPAPAPVENAPK
TPTWWTEPPLGVHRLTVRTPDHRHITATLVVAPDRVPQPPPRTHGFLVQLYSMLSARSWG
MGDLADLADLAAWAGRTLGSGFVQVNPLHAAVPGRPTDPSPYRPSSRRFPDPVHLHIESI
PEYGHVGEPGRAALDDLRQEAAALREAVLNKGALIDRDAVWALKKQALEIVHEVPLTPGR
RAAYCDFLAAQGQALEDHALWCALAEVHGPQWRAWPAGLRDPRSPQSARARTELLDRVDF
HCRLAWLTDTQLATAQSAARESGMPVGIVHDLAVGVHPDGADTWAQQDAFARGMSVGAPP
DAFNAHGQDWGLPPWRPDALAASGYAPYRDLLRGLLAHAGALRIDHVMGLFRLWWVPEGR
PPTEGAYVAQDAEAMLAVLVLEAHRAGAVVVGEDLGTVEPGVREALARRGVLGTSVLWFE
RDWAGSGRPLAPGAWRQGCVATATTHDLPSTAARLTGEHVTLRHRLGLLTHPLERELAED
AADTAEWLAYLARLRLLPEGEGDEEAAVRAVHRFLRSTPALMSGVWLPDAVGDRRPQNLP
GTWDQYPNWRLPVADAEGHPVTLEEITASPRLHRLMAVLTDGPESRTAPPDARPS
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgtcccggctcgccgcactgcacggcgtcgccacctccttctccccgtccgcg
gacgtcacggtgcccgtccccgacgacacggtcacggccgtgctcgccgcgctgggcgtc
gacgccgacacgcccgccgacgtacggagatcgctcgccgcagccgaatcggcggcggct
tcccgactgctcccgccgacggtggttgcctggtcgggggagccgctgccggccgcgctc
gccgcactgccggccggcgcgctcctcacggtcgaccccgagccgggcaccaccggcgca
ccccggcccctgcgtatgcgggtcctgcccgcccccgcacccgtcgagaacgcgccgaag
acgcccacctggtggaccgaaccgcccctgggcgtccaccggctgaccgtccgcaccccg
gaccaccgccacatcaccgccacgctcgtcgtcgctccggaccgcgtaccccagccgccc
ccgcgcacgcacggattcctcgtccagctctactcgatgctctccgcccgctcctggggc
atgggcgacctcgcggacctggccgacctcgccgcatgggcggggcggaccctcggcagc
ggattcgtccaggtcaacccgctgcacgccgccgtgcccggccggcccaccgacccgtcc
ccgtaccggccctcctcgcgccgcttccccgaccccgtgcatctgcacatcgagtcgatc
cccgagtacggccacgtcggcgagcccggcagggcggccctggacgacctgcgccaggaa
gccgcggcgctgcgcgaggccgtgctgaacaagggcgcgctgatcgaccgtgacgccgtc
tgggcgctcaagaagcaggccctggagatcgtccacgaggtccccctgacccccggccgc
cgtgccgcctactgcgacttcctggccgcgcaggggcaggccctggaggaccacgccctg
tggtgcgccctggccgaggtgcacggcccgcagtggcgcgcctggcccgcagggcttcgc
gacccccgctccccgcagagcgcccgggcccgcaccgaactgctcgacagggtcgacttc
cactgccggctcgcctggctcacggacacccagctcgccaccgcccagagcgccgcccgg
gagtccgggatgcccgtcgggatcgtccacgacctcgccgtcggcgtacaccccgacggc
gccgacacctgggcacagcaggacgccttcgcccggggcatgtccgtcggcgcgcccccc
gacgccttcaacgcccacggccaggactggggacttcccccctggcggccggacgccctc
gcggcgtccggatacgccccctaccgcgacctcctgcggggcctcctcgcccacgccggc
gcgctgcgcatcgaccacgtcatgggcctcttccggctctggtgggtccccgaggggcgc
ccgcccaccgagggtgcctacgtcgcccaggacgccgaggcgatgctcgccgtcctcgtc
ctggaggcgcaccgggcgggtgccgtcgtcgtaggggaggacctcggcaccgtcgagccc
ggcgtgcgcgaggcgctggcccggcgcggggtgctcggcacttccgtgctctggttcgag
cgcgactgggcggggagcgggcgcccgctggcccccggggcctggcgccagggctgcgtg
gccacggcgaccacccacgacctgccctccaccgccgcgcggctgacgggtgaacacgtg
acgctccgccaccggctcgggctgctgacccaccctctggagcgggagctggccgaggac
gcggccgacaccgccgaatggctcgcctacctggcccggctccggctgctgcccgagggc
gagggggacgaggaggcggccgtccgcgcggtccaccgcttcctgcggagcaccccggcc
ctgatgtccggcgtctggctcccggacgccgtgggggaccgccgcccgcagaacctgccc
gggacctgggaccagtaccccaactggcgcctgcccgtcgccgacgcggaaggccatccc
gtcaccctggaggagatcacggcctcaccccggctgcaccggctgatggccgtcctgacg
gacggtccggagtcccgtacggcacccccggacgcgcgcccctcgtag

DBGET integrated database retrieval system