KEGG   Streptomyces sp. PAMC26508: F750_4437Help
Entry
F750_4437         CDS       T02619                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
strp  Streptomyces sp. PAMC26508
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    F750_4437
Enzymes [BR:strp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     F750_4437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4610536..4611813
Genome map
AA seq 425 aa AA seqDB search
MDAISVIRTKRDRGELSPEQIDWVIDAYTRGEVADEQMSALAMAILLNGMNRTEIARWTA
AMIASGERMDFGALSRPTTDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTGGT
LDKLESIPGWRAHISNAEMLDVLDTTGAVICAAGDGLAPADKKLYALRDVTGTVEAIPLI
ASSIMSKKIAEGTGALVLDVKVGSGAFMKTIEDARELASTMVALGTDSGVRTVALLTDMS
TPLGLTAGNALEVRESVEVLAGGGPKDVVDLTLALAREMLDAAGLKDADPEKALADGSAM
DVWRRMISAQGGDPDARLPVAREQHVISAPSSGVLTRLDAYDVGVAAWRLGAGRARKEDP
VQAGAGVELHAKPGDTVAEGQPLMTLHTDTPEKFEYALKALPGSYDIAPAGTPFTATPVV
RERIA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatctccgtcatccgcaccaagcgggaccggggcgagctcagccccgagcag
atcgactgggtcatcgacgcgtacacgcgcggcgaggtcgccgacgagcagatgtccgcg
ctggccatggcgatcctgctcaacggcatgaaccgcaccgagatcgcccgctggaccgcc
gcgatgatcgcctccggcgagcggatggacttcggcgcgctctcccgccccaccaccgac
aagcactccaccggcggcgtcggcgacaagatcaccctgccgctcgccccgctggtcgcc
gcctgcggtgccgcggtgccgcagctgagcggtcggggcctcggccacaccggtggcacc
ctcgacaagctggagtccatccccggctggcgcgcccacatctccaacgccgagatgctc
gacgtcctcgacaccaccggcgccgtgatctgcgcggcgggcgacggcctcgcccccgcc
gacaagaagctgtacgcgctgcgcgacgtcaccggcaccgtcgaggcgatcccgctcatc
gccagctcgatcatgtccaagaagatcgccgagggcaccggcgcgctcgtcctcgacgtg
aaggtcggctccggcgccttcatgaagaccatcgaggacgcccgcgaactggcctccacc
atggtcgcgctgggcaccgacagcggtgtccgcacggtcgccctgctcaccgacatgtcc
accccgctgggcctgaccgcgggcaacgccctggaggtccgcgagtccgtcgaggtcctc
gccggtggcggccccaaggacgtcgtcgacctgaccctggcgctcgcccgcgagatgctc
gacgcggccgggctcaaggacgccgacccggagaaggccctggccgacggctccgcgatg
gacgtctggcgccggatgatctcggcccagggcggcgacccggacgcgcgactccccgtc
gcccgcgagcagcacgtgatcagcgccccgtcctcgggcgtgctgacgcgcctggacgcc
tacgacgtcggcgtcgccgcctggcgcctcggcgccggccgcgcacgcaaggaggacccg
gtgcaggccggcgcgggcgtcgaactccatgccaagccgggcgacacggtggccgagggc
cagccgctgatgaccctgcacacggacacccccgagaagttcgagtacgcgctcaaggcg
cttccgggctcgtacgacatcgccccggcgggcacccccttcaccgccacgccggtggtg
cgggaacgtatcgcctga

DBGET integrated database retrieval system