KEGG   Streptomyces sp. PAMC 26508: F750_4523Help
Entry
F750_4523         CDS       T02619                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
strp  Streptomyces sp. PAMC 26508
Pathway
strp00220  Arginine biosynthesis
strp00250  Alanine, aspartate and glutamate metabolism
strp00290  Valine, leucine and isoleucine biosynthesis
strp01100  Metabolic pathways
strp01110  Biosynthesis of secondary metabolites
strp01130  Biosynthesis of antibiotics
strp01210  2-Oxocarboxylic acid metabolism
strp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:strp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    F750_4523
   00290 Valine, leucine and isoleucine biosynthesis
    F750_4523
   00220 Arginine biosynthesis
    F750_4523
Enzymes [BR:strp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     F750_4523
    2.6.1.66  valine---pyruvate transaminase
     F750_4523
Amino acid related enzymes [BR:strp01007]
 Aminotransferase (transaminase)
  Class I
   F750_4523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGJ56964
UniProt: M9U2Q8
Position
complement(4689241..4690452)
Genome map
AA seq 403 aa AA seqDB search
MQVIQSTKLSGVCYEIRGPVLEEAMRLEAAGHRILKLNTGNPAAFGFECPPEILEDILRN
LSGAHGYGDAKGLLSARRAVMQHYQTKGIDLDVEDVYLGNGVSELIQMSMQALLDDGDEV
LVPAPDYPLWTASVSLAGGTAVHYRCDEQADWMPDLADIERKITDRTKALVIINPNNPTG
AVYDDEMLRGLTEIARRHNLVVCSDEIYDRILYDGATHTPTAAIAPDLMVLTFNGLSKNY
RIAGYRSGWMAVCGPKAHASSYIEGLTILANMRLCANMPAQHAVATALGGRQSIDELVLP
GGRILEQRDVAYDLLTRIPGVTCVKPKGALYLFPRLDPKVFKIKDDRQMVLDLLRAEKIM
VVQGTGFNWPEPDHFRVVTLPPAKDLTDAVTRIGNFLDGYSQP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcatccagtcaacgaagctctccggcgtctgttacgagatccgcggccccgtc
ctcgaagaggcgatgcggctcgaagccgcaggtcatcgcatcctcaagctgaacaccggg
aacccggccgcgttcgggttcgagtgcccgccggagatcctcgaggacatcctgcgcaac
ctgtccggcgcgcacggctacggcgacgcgaagggcctgctgtccgcgcgccgcgcggtg
atgcagcactaccagaccaagggcatcgacctggacgtcgaggacgtctacctgggcaac
ggcgtctccgagctgatccagatgtcgatgcaggcactgctcgacgacggcgacgaggtg
ctcgtccccgctccggactatcccctgtggacggcctcggtctcgctggccggcggcacg
gcggtgcactaccggtgcgacgagcaggccgactggatgcccgacctcgccgacatcgag
cggaagatcaccgaccgcaccaaggcgctggtgatcatcaacccgaacaatccgaccggc
gcggtctacgacgacgagatgctgcgagggctgacggagatcgcccggcgccacaacctg
gtcgtctgctccgacgagatctacgaccggatcctctacgacggcgcgacacacaccccg
accgccgcgatcgccccggacctgatggtcctcaccttcaacgggctctccaagaactac
cggatcgcgggataccgctccggctggatggcggtctgcggcccgaaggcgcacgcgtcc
tcgtacatcgagggcctgacgatcctggccaacatgcggctgtgcgccaacatgcccgcg
cagcacgcggtggccaccgcgctcggcgggcggcagtcgatcgacgaactggtgctgccg
ggcggccggatcctggaacagcgggacgtggcgtacgacctgctgacccggatccccggg
gtgacctgcgtgaagccgaagggggcgctgtacctcttcccgaggctcgaccccaaggtc
ttcaagatcaaggacgaccggcagatggtcctcgacctgctgcgggccgagaagatcatg
gtggtgcagggcaccggattcaactggcccgagcccgatcacttccgggtggtcacgctg
ccgccggcgaaggacctgaccgacgcggtgacccgtatcggaaacttcctggacggctac
agccagccctga

DBGET integrated database retrieval system