KEGG   Streptomyces sp. PAMC26508: F750_5023Help
Entry
F750_5023         CDS       T02619                                 

Definition
glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
strp  Streptomyces sp. PAMC26508
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    F750_5023
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    F750_5023
Enzymes [BR:strp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     F750_5023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5224853..5226721)
Genome map
AA seq 622 aa AA seqDB search
MIRTSRTASVLVATALATAGLAGLSPGTAQAAGETVNIVLTTTDDSGGRHVTRGLQAQTP
VAFGAGNGGSGTNITVDENTRYQTFTGGGASFTDTAAWLMKGSGALSQATRDATMKKLFS
PTEGIGLSFVRNPMGGSDLARFGYTYDDMPAGQTDPNLANFSIAHDLQDVLPLTKQAEQL
NPALTTVASPWTAPAWMKDNGQLNGGWLKAENYGAYANYFVKYLQAWRDQGVPVDYVTAQ
NEPTCCSGYPSMSWNGSGLAYFTKSELLPKLRSAGLATKVLAHDWNWDSYDAYAAPTVDD
PAVRDHPNFGGVAWHGYGGDVAKQTAVHDRYPQLDAFQTEHSGGTWIADQQREDMLNIID
YTRNWAKSVTKWSLAVDQNRGPHNGGCGTCDGLVTVHNGDSRHGQVDYTIEYYTMGHLTK
YVRPGAARIASTGSSAVPNVAWRNPDGSKALIAYNGSASAQQVTVNWGGQKFTYSLPGRT
SATFTWSGTQSGSSGSTGALTGNGGKCLDATGHSGSDGTPVQIWDCTGAANQKWTVSGDG
SVKVLGACLDVTSGSTADGAKVQLYTCNGSGAQRWTYDSSTGDLVNTAADKCLDVADRST
ADGARVQIWTCTGAANQKWRLR
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgatccggacaagcagaacggcgagcgtcctcgtcgccacggcgctcgcgaccgcggga
ctggccgggctctccccgggcaccgcgcaggccgccggtgagaccgtgaacatcgtgctg
accaccacggacgactccggcggccgtcacgtcacccgcggcctccaggcccagacaccg
gtcgccttcggtgccgggaacggcggctcgggcacgaacatcaccgtcgacgagaacacc
cgctaccagaccttcaccggaggcggcgcctcgttcacggacacggcggcctggctgatg
aagggcagcggggccctgagccaggccacccgcgacgcgacgatgaagaagctcttctca
ccgacggagggcatcggattgtccttcgtacgcaatccgatgggcggatcggacctcgcg
cgattcggttacacctacgacgacatgcccgccgggcagacggacccgaatctcgcgaac
ttctcgatcgcacatgatctccaggacgtcctgccgctcacgaagcaggccgagcagctc
aaccccgcgctgacgacggtggcctccccgtggacggcaccggcctggatgaaggacaac
gggcagctgaacggcggctggctgaaggccgagaactacggcgcctacgcgaactacttc
gtgaagtacctccaggcgtggcgggaccagggcgtcccggtcgactacgtcaccgcccag
aacgaacccacctgctgctccggctacccgtcgatgagctggaacggctcgggtctcgcc
tacttcaccaagagcgagctgctgccgaagctccggtcggcgggcctggccaccaaggtg
ctggcgcacgactggaactgggacagctacgacgcctacgccgcccccaccgtcgacgac
ccggccgtgcgcgaccacccgaacttcggcggggtcgcctggcacggctacggcggtgac
gtcgcgaagcagacggccgtccacgaccggtacccgcagctggacgccttccagaccgag
cactcgggcggcacctggatcgccgaccagcagcgcgaggacatgctgaacatcatcgac
tacacccgcaactgggcgaagtcggtgaccaagtggtcgctcgccgtcgaccagaaccgc
ggcccccacaacggcggttgcggcacctgcgacgggctggtcaccgtgcacaacggggac
agcaggcacggccaggtcgactacacgatcgagtactacacgatgggccacctgacgaag
tacgtccgacccggcgccgcccgcatcgcgtcgacgggcagctccgccgtgcccaacgtg
gcatggcgcaaccccgacggctcgaaggccctcatcgcctacaacgggtcggcctccgcc
cagcaggtcaccgtcaactggggcgggcagaagttcacctactccctgccgggccggacc
tcggcgacgttcacctggtcgggcacccagtcgggctcctccggcagcaccggcgccctc
accgggaacggcggcaagtgcctcgacgccacgggccacagcggctcggacggcacaccg
gtgcagatctgggactgcaccggcgcggccaaccagaagtggacggtgtccggcgacggc
tcggtcaaggtgctcggcgcctgcctggacgtgacgtcgggctcgacggcggacggagcg
aaggtccagctgtacacctgcaacgggtcgggcgcgcaacgctggacgtacgactcctcg
acgggggacctcgtcaacacggccgcggacaagtgcctggacgtggccgaccggtccacc
gccgacggggcccgtgtccagatatggacgtgcaccggcgcggccaaccagaagtggcgg
ctgcggtaa

DBGET integrated database retrieval system