KEGG   Streptomyces sp. PAMC26508: F750_6087Help
Entry
F750_6087         CDS       T02619                                 

Definition
rhamnogalacturonan acetylesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
strp  Streptomyces sp. PAMC26508
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    F750_6087
   00500 Starch and sucrose metabolism
    F750_6087
Enzymes [BR:strp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     F750_6087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6487082..6488116
Genome map
AA seq 344 aa AA seqDB search
MTAGAATLLAAATVWTSGSASGTEAATTLTVAKDGSGQYTTVQAAVNAIPAGNTARVVVS
IRPGTYRELVKIPSTKQNVTLQGSGASRNDTVIVYNNASGTRKPDGSGTYGTSGSATVAA
EANGFQARNLTISNDFDEAANQNLSGLQAVALRTAADKVFLDSVIVTGDQDTLLLDTASK
ATLGRVYMTNSYVVGNVDFIFGRATAVIDKSVITLKKRWDGSSAGYIAAPSTAADRKGFL
ITGSTVNGDVSASSFYLGRPWHAGGDATLDPMATFRGTTLSSAIRSAPWTDMSGFSWKDD
RFAEYRNAGPGSGSASSNRPQLTDAQAAEQETADWLAGWTPSAS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgggggcggccacgctgctcgccgccgccacggtgtggacctccgggtccgcg
tccggcaccgaggccgcgaccaccctcaccgtcgccaaggacggcagcgggcagtacacg
accgtgcaggcggcggtcaacgcgatccccgcgggcaacaccgcgcgggtcgtcgtctcc
atcaggcccggcacctaccgggaactggtgaagatcccgtccaccaagcagaacgtcacc
cttcagggcagcggagcgagccgcaacgacaccgtcatcgtctacaacaacgcctcgggc
acgcggaagcccgacggctccggcacctacggcaccagcggcagcgcgaccgtcgcggcg
gaggccaacggcttccaggcccgtaatctcacgatctccaacgacttcgacgaagccgcc
aaccagaacctgagcgggctccaggccgtggccctgcgcaccgcggcggacaaggtcttc
ctggactccgtgatcgtcaccggtgaccaggacaccctgctgctcgacaccgcctccaag
gcgacgctcggccgtgtctacatgacgaactcctacgtcgtgggcaacgtcgacttcatc
ttcggacgcgccaccgccgtgatcgacaagtccgtcatcacgctgaagaagcgctgggac
ggcagctccgccggctacatcgccgccccgagcacggccgccgaccgcaagggcttcctg
atcaccggctcgaccgtcaacggcgacgtctcggcgtcgtccttctacctcggccgcccg
tggcacgcggggggtgacgccacgctcgaccccatggccaccttccgcggcaccacgctc
agctcggcgatcaggtccgccccgtggacggacatgagcggcttctcctggaaggacgac
cgtttcgcggagtaccggaacgccgggcccggatcaggctcggcgagcagcaaccggccc
cagctcaccgacgcccaggccgcggaacaggagaccgccgactggctggcgggctggaca
ccctcggcctcctga

DBGET integrated database retrieval system