KEGG   Streptomyces sp. PAMC26508: F750_6118Help
Entry
F750_6118         CDS       T02619                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
strp  Streptomyces sp. PAMC26508
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    F750_6118
   00051 Fructose and mannose metabolism
    F750_6118
Enzymes [BR:strp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     F750_6118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6527955..6529124
Genome map
AA seq 389 aa AA seqDB search
MTDRFTPTPADRFTFGLWTVGWRGNDPFGDATRPVLDPVESVERLAELGAHGVTFHDDDL
IPFGSDEKERARLVGRFKDALERTGMKVPMATTNLFTHPVFKDGGFTSNDRDVRRFALRK
VIRNIDLAAELGASTYVAWGGREGAESGGAKDVRLALDRMKEAFDLLGDYVTEQGYDLRF
AIEPKPNEPRGDILLPTIGHALAFIERLERPEMVGVNPETGHEQMAGLNFPHGIAQALWA
GKLFHIDLNGQSGIKYDQDFRFGAGDLRQAFWLVDLLESAGYDGSLHFDFKPVRTDGIDG
VWESAKNCMRNYLILKERAAAFRADPAVQEALTASRLHELARPTADDGLKALLADTSAYE
NFDATAAAERSMAFEALDQLAMEHLLGVR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgacggaccgcttcactcccactcccgcggacaggttcacgttcggtctgtggacggtg
ggctggcgtggcaacgacccgttcggtgacgcgacgcgtccggtgctggatccggtggag
tcggtggagcggctcgcggagctgggggcgcacggtgtgacgttccatgacgacgacctg
atcccgttcgggtcggacgagaaggagcgggcccggctggtcgggcggttcaaggacgcg
ttggagcggaccgggatgaaggtcccgatggcgacgacgaacctgttcacgcacccggtg
ttcaaggacggcgggttcacctcgaacgaccgtgacgtgcggcgtttcgcgctgcgcaag
gtgatccggaacatcgatctggccgccgagctgggtgcgtccacgtatgtggcctggggc
gggcgtgagggtgcggagtccgggggtgccaaggacgtgcggctggcgctggaccggatg
aaggaggccttcgacctgctgggcgactacgtcaccgagcagggctacgacctgcggttc
gcgatcgagcccaagcccaacgagccccgcggcgacatcctgctgcccacgatcggccac
gccctggcgttcatcgagcgtctggagcgcccggagatggtcggggtgaacccggagacc
gggcacgagcagatggccgggctgaacttcccgcacggtatcgcgcaggccctgtgggcc
ggcaagctcttccacatcgacctcaacggccagtccggcatcaagtacgaccaggacttc
cgtttcggcgccggggacctgcgccaggcgttctggctcgtcgacctgctggagagcgcc
ggctacgacggatcgctgcacttcgacttcaagcccgtgcgcaccgacggcatcgacggg
gtctgggagtccgcgaagaactgcatgcgcaactacctcatcctcaaggagcgcgccgcc
gcgttccgcgcggaccccgccgtccaggaggccctgaccgcctcccgcctccacgagctc
gcccgccccaccgccgacgacggcctcaaggccctcctcgccgacacctccgcctacgag
aacttcgacgccaccgccgccgcggaacgctccatggccttcgaagccctcgaccagctc
gccatggaacacctcctcggcgtccgctga

DBGET integrated database retrieval system