KEGG   Streptomyces sp. PAMC26508: F750_6168Help
Entry
F750_6168         CDS       T02619                                 

Definition
(RefSeq) ATP-dependent DNA ligase (EC:6.5.1.1)
Organism
strp  Streptomyces sp. PAMC26508
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6575829..6576839
Genome map
AA seq 336 aa AA seqDB search
MELDVDGRAVRLSNPDKVYFPEKGYTKKDVADYFQAVGPGILRALRERPTTLQRFVDGVE
GDFFYQKRAPKNLPDWTPTARIEFPSGRHADEMCPTELGAVLWAANLGTLTFHPWPVRRA
DTDHPDELRIDLDPQPGTDYADAVRAAHELRAVLDDHGLRGWPKTSGGRGIHVFVPLVPE
WTFTQVRRSAIAVGRELERRMPDRVTTAWWKEERGERIFVDYNQTARDRTIASAYSVRPF
PHAPVSAPLRWEEIDDAEPRDFDLRTMPARYAEAGDLHADMDDHAFRLDGLLELARRDEH
EHELGDLPYPPEYPKMPGEPKRVQPSRARRDDGDPA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtggagctggacgtggacggacgggccgtgcgcctgtccaacccggacaaggtgtacttc
cccgagaagggctacaccaagaaggacgtggccgactacttccaggccgtggggccgggg
atcctccgggccctgcgcgagcggcccaccacgctccagcgcttcgtcgacggtgtcgag
ggcgacttcttctaccagaagcgggcgccgaagaacctccccgactggacccccaccgcc
aggatcgagttccccagcggccggcacgccgacgagatgtgccccaccgaactcggagcc
gtcctctgggcggcgaacctgggcaccctgaccttccacccctggccggtgcgcagggcg
gacaccgaccaccccgacgaactgcgcatcgacctcgacccgcagcccggcacggattac
gccgatgcggtgagggcggcccacgaactgcgcgcggtcctggacgaccacggcctgcgc
ggctggcccaagacctccggcggccgcggcatccacgtcttcgtcccgctcgtccccgag
tggacgttcacccaggtcagacgctcggccatcgcggtggggcgggagctggagcgccgg
atgcccgaccgggtgaccaccgcctggtggaaggaggaacgcggcgagcggatcttcgtc
gactacaaccagacggcccgcgaccggaccatcgcctccgcctactccgtacgccccttc
ccgcacgcccccgtctccgccccgctgcgctgggaggagatcgacgacgccgagccccgc
gacttcgacctccggaccatgccggcgcggtacgcggaggccggcgacctgcacgccgac
atggacgaccacgccttccgcctcgacgggctgctcgaactggcccgacgcgacgagcac
gagcacgaactcggcgacctgccctatccgccggagtacccgaagatgccgggtgagccg
aaacgggtgcagcccagccgcgcccgccgcgacgacggtgacccggcatga

DBGET integrated database retrieval system