KEGG   Streptomyces sp. PAMC26508: F750_6244Help
Entry
F750_6244         CDS       T02619                                 

Definition
NAD-specific glutamate dehydrogenase NADP-specific glutamate dehydrogenase (EC:1.4.1.2)
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
strp  Streptomyces sp. PAMC26508
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strp00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    F750_6244
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    F750_6244
   00330 Arginine and proline metabolism
    F750_6244
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    F750_6244
Enzymes [BR:strp01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     F750_6244
Exosome [BR:strp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   F750_6244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6655296..6656537)
Genome map
AA seq 413 aa AA seqDB search
MPSPSPAPLISLTWTDHVTGTEGYLVVDRLVRGVSSGGLRMRKGCTLAEVTGLARGMTMK
EALHFDADSPARYIPLGGAKGGIDCDPRDPAAYGVLVRFLRAVRPYVENVWTTGEDLGLG
QDVVDRAAEEAGLVSTVQAVYPLLEDEQEARRRLADAFAVTVRGIGLDELVGGCGVAESA
LAALDRAGVAHSGTRVSLQGLGTMGGATARFLADAGLSIVAVADVKGTIANSAGLDVDAL
LAARDAHGAVDRGALRAEDQELPGDAWLGTDAEILVPAAVSYAVDAVNQAAIRARWVVEA
ANMPVLPEAEALLVGRGITVLPDVVVNSATNAWWWWTLFGDIGPDAEEAFRHTRRSMRAL
VDRVLERAAADGCTPRAAAHALAADRLPVMAERFGWYGQPLGRTARDPGRGVG
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgccgtccccctcccccgccccgttgatctccctgacctggacggaccacgtcacgggc
acggaggggtacctcgtcgtcgaccggctggtgcgcggggtgtccagcggtggtctgcgg
atgcggaagggctgcaccctcgccgaggtcacgggcctggcccggggcatgaccatgaag
gaggccctgcacttcgacgccgactcgccggcgcgctacatcccgctgggcggcgcgaag
ggcggtatcgactgcgacccccgggatccggccgcctacggagtgctcgtccgcttcctg
cgggccgtgcgcccgtacgtggagaacgtctggacgaccggggaggacctcggtctcggc
caggacgtcgtggaccgggcagctgaggaagccgggctcgtctccaccgtccaggccgtc
taccccttgctcgaggacgaacaggaagcccgccggcggcttgcggacgccttcgccgtc
acggtccgggggatcgggctggacgagctggtcggcgggtgcggagtcgcggagtccgcg
ctcgccgcgctggaccgggccggcgtggcgcactccggcacccgggtgtccctgcagggg
ctgggcaccatggggggcgccacggcacggttcctcgccgacgcggggctgagcatcgtc
gcggtcgccgacgtcaagggcacgatcgccaactcggcgggcctggacgtcgacgcgctc
ctggccgcgcgggacgctcacggggcggtggaccgcggtgctctgcgggccgaggaccag
gagctgccgggcgatgcctggctgggcaccgatgcggagatcctggtaccggccgccgtg
tcgtacgcggtcgacgccgtgaaccaggctgcgatccgcgctcgctgggtggtcgaggcc
gcgaacatgcccgtgctccccgaggcggaagcactgctcgtcgggcgcgggatcaccgtg
ctgccggatgtggtcgtcaactccgcgacgaacgcgtggtggtggtggacgctgttcggg
gacatcgggcccgacgcggaggaggcgttccggcacacccgccgctccatgcgcgccctt
gtcgaccgcgtgctggagcgtgcggcggcggacggctgcacaccgcgggcggccgcgcac
gccctcgccgccgaccggctgccggtgatggcggagcggttcggctggtacggacagccc
ctcggccgaacggcccgagaccccggccggggcgttggttaa

DBGET integrated database retrieval system