KEGG   Streptomyces sp. PAMC 26508: F750_6288Help
Entry
F750_6288         CDS       T02619                                 

Definition
(GenBank) hypothetical protein
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
strp  Streptomyces sp. PAMC 26508
Pathway
strp00500  Starch and sucrose metabolism
strp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    F750_6288
Enzymes [BR:strp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     F750_6288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6
Motif
Other DBs
NCBI-ProteinID: AGJ58714
UniProt: M9U7K3
Position
6704294..6705235
Genome map
AA seq 313 aa AA seqDB search
MAALCALPLAFAAAPPAHAADPTTMTNGFYADPDSSASRWAAANPGDGRAAAINASIANT
PMARWFGSWSGAIGTAAGAYAGAADGRDKLPVLVAYNIYNRDYCGGHSAGGAASPSAYAD
WIARFAGGIAARPAVVILEPDSLGDYGCMNPAQIDEREAMLTNALVQFNRQAPNTWVYMD
AGNPRWADAATMARRLHEAGLRQAHGFSLNVSNYITTAENTAYGNAVNNELAARYGYTKP
FVVDTSRNGNGSNGEWCNPSGRRIGTPTRTGGGAEMLLWIKTPGESDGNCGVGSGSTAGQ
FLPEVAYKMIYGY
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgctctgtgcgctgccgctggcgttcgccgccgcaccccccgcccacgccgcc
gaccccaccaccatgaccaacgggttctacgcggatcccgactcgagcgcgagccggtgg
gcggccgccaaccccggcgacggccgggccgccgcgatcaacgcctccatcgccaacaca
cccatggcccgctggttcggctcctggagcggcgccatcggcaccgcggcaggcgcctac
gccggagcggcggacggccgggacaagctgcccgtcctcgtcgcctacaacatctacaac
cgtgattactgcggcgggcactccgccggtggagccgcttcgccgtccgcgtacgccgac
tggatcgctcggttcgccggaggtatcgcggcccgcccggccgtcgtcatcctcgaaccg
gactctctcggagactacggctgcatgaacccggcccagatcgacgaacgcgaggccatg
ctcaccaacgccctcgtccagttcaaccgccaagctcccaacacctgggtctacatggat
gccggcaacccgcgctgggccgacgcggcgaccatggcccggcgtctccacgaagccggt
ctgcgacaggcccacggcttctcgctcaacgtctccaactacatcaccaccgccgagaac
accgcctacggcaacgccgtcaacaatgaactggccgctcgctacggctacaccaagccg
ttcgtcgtggacaccagccgcaacggcaacggctccaacggcgagtggtgcaacccctcc
ggccgccgcatcggcacgcccacccggacaggtggaggcgccgagatgctcctgtggatc
aagactccgggcgagtccgacggcaactgcggtgtgggatccggctccacggccggccag
ttcctccccgaggtcgcctacaagatgatctacggctactga

DBGET integrated database retrieval system