KEGG   Streptomyces sp. PAMC26508: F750_6288Help
Entry
F750_6288         CDS       T02619                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
strp  Streptomyces sp. PAMC26508
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:strp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6704294..6705235
Genome map
AA seq 313 aa AA seqDB search
MAALCALPLAFAAAPPAHAADPTTMTNGFYADPDSSASRWAAANPGDGRAAAINASIANT
PMARWFGSWSGAIGTAAGAYAGAADGRDKLPVLVAYNIYNRDYCGGHSAGGAASPSAYAD
WIARFAGGIAARPAVVILEPDSLGDYGCMNPAQIDEREAMLTNALVQFNRQAPNTWVYMD
AGNPRWADAATMARRLHEAGLRQAHGFSLNVSNYITTAENTAYGNAVNNELAARYGYTKP
FVVDTSRNGNGSNGEWCNPSGRRIGTPTRTGGGAEMLLWIKTPGESDGNCGVGSGSTAGQ
FLPEVAYKMIYGY
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgctctgtgcgctgccgctggcgttcgccgccgcaccccccgcccacgccgcc
gaccccaccaccatgaccaacgggttctacgcggatcccgactcgagcgcgagccggtgg
gcggccgccaaccccggcgacggccgggccgccgcgatcaacgcctccatcgccaacaca
cccatggcccgctggttcggctcctggagcggcgccatcggcaccgcggcaggcgcctac
gccggagcggcggacggccgggacaagctgcccgtcctcgtcgcctacaacatctacaac
cgtgattactgcggcgggcactccgccggtggagccgcttcgccgtccgcgtacgccgac
tggatcgctcggttcgccggaggtatcgcggcccgcccggccgtcgtcatcctcgaaccg
gactctctcggagactacggctgcatgaacccggcccagatcgacgaacgcgaggccatg
ctcaccaacgccctcgtccagttcaaccgccaagctcccaacacctgggtctacatggat
gccggcaacccgcgctgggccgacgcggcgaccatggcccggcgtctccacgaagccggt
ctgcgacaggcccacggcttctcgctcaacgtctccaactacatcaccaccgccgagaac
accgcctacggcaacgccgtcaacaatgaactggccgctcgctacggctacaccaagccg
ttcgtcgtggacaccagccgcaacggcaacggctccaacggcgagtggtgcaacccctcc
ggccgccgcatcggcacgcccacccggacaggtggaggcgccgagatgctcctgtggatc
aagactccgggcgagtccgacggcaactgcggtgtgggatccggctccacggccggccag
ttcctccccgaggtcgcctacaagatgatctacggctactga

DBGET integrated database retrieval system