KEGG   Streptomyces sp. PAMC26508: F750_6950Help
Entry
F750_6950         CDS       T02619                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
strp  Streptomyces sp. PAMC26508
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:strp00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:strp00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:strp00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7425802..7427961)
Genome map
AA seq 719 aa AA seqDB search
MPHIEIDRPSGTVLLRASDTSYVLRVDTATGTVRTLHWGASLSLDDARSLLEPDPATDSF
RSPLDGTEELAVDGQVRFAPPALDVRYGDGTSAVEPVVDGYDVRRDGDSSELSVRLRDHG
RPLAWTLHYRVRQDCPVIERWTVFRHTGPGPAEPGEEPALSLVRHSAAQWNLPVLPAYRM
SSVHGQWAGEFQLRRTPLAVGETTVSSRRGHTGHQSNPWLALDAGDATEETGEVWTVALA
TAGSWRMTAVRSAEGRCGVLGGSGHEGVEITLAPGASWTTPVSTGLYAPGGFGGASRAYH
SYVRRYVLPAPDEPRPVLYNSWEATAFDVTFDGQRELADLAARVGAELFVVDDGWFGARD
SDRAGLGDWTPRPGAFPDGLRPLADHVHGLGMRFGLWVEPEMVNPDSDLFRAHPEWVLHL
PDRTAHTLRNQLVLDFSRPEVTDWALTWLLRTVDAFAVDFLKWDFNRSFTEAGSAGRHPD
ARRVFVDHALGAHEVMDRLRAARPALRIETCSGGGGRVDLASLARTDQAWTSDNTDAVDR
LGIQYGFSQLYPAQVMGAWVTDSPNPITLRTVPLRFRLHSAMAGALGIGGDLTRWPEAEL
DETAAYVALYKTVRSTVQTGRQYRLGSPADSSHAVQYVARDGDESVVFQWRAGPEERAAL
PRLRLRGLVPEAVYRVDDDSEITRAGTVRSGAALMAHGLSAQLPRGGYASRMLTLRREG
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgccccacatcgagatcgaccgcccgtcggggaccgtgctgctccgcgcctccgacacc
agctacgtcctgcgggtcgacacggcgaccgggaccgtgcgcacgctccactggggggcc
tccctctccctcgacgacgcccgctcgctgctggagccggaccccgctacggacagtttc
cgcagccccctggacggcacggaggaactggcggtcgacggacaggtgcggttcgccccg
cccgcactcgatgtgcggtacggggacgggaccagcgcggtcgagcccgtcgtggacggc
tacgacgtccggcgggacggcgacagctcggagctgtccgtcaggctccgcgaccacggc
cgcccgctcgcgtggacgctgcactaccgcgtccggcaggactgcccggtgatcgaacgc
tggaccgtgttccggcacacgggccccgggccggcggagcccggcgaggagccggcgctc
tcgctcgtacggcattcggccgcccagtggaatctgccggtcctgcccgcgtaccggatg
agttccgtgcacgggcagtgggcgggcgagttccagctgcggcggaccccgctcgccgtg
ggcgagacgacggtcagcagccggcgtggtcacacgggtcaccagagcaacccctggctc
gccctcgacgccggggacgccaccgaggagacgggcgaggtctggacggtcgccctcgcc
accgcgggaagctggcggatgacggcggtgcggtccgcggagggccggtgcggggtgctg
ggcggcagcggtcacgagggcgtggagatcaccctcgcgcccggcgcgagctggaccact
cccgtgagcaccggcctgtacgcaccaggggggttcggcggagcgtcccgggcgtaccac
tcctacgtacggcgatacgtgctgcccgcccccgacgaaccacgccccgtgctctacaac
tcctgggaggcgacggccttcgacgtcaccttcgacgggcagcgggaactggcggacctg
gccgcgcgcgtcggggccgagctgttcgtggtcgacgacggatggttcggggcccgcgac
agcgaccgcgcgggtctcggcgactggacccctcggccgggcgccttccccgacgggctg
cgcccgctcgccgaccacgtccacgggctgggcatgcggttcgggctgtgggtggagccg
gagatggtcaatcccgacagtgatctgttccgcgcgcacccggagtgggtgctgcacctg
cccgaccgcaccgcccacaccctgcgcaaccagctggtgctcgacttctcgcggcccgag
gtgacggactgggcgctcacctggctgctgcgcaccgtcgacgcgttcgctgtggacttc
ctcaagtgggacttcaaccggtcgttcacggaggcgggttccgccggtcgccaccccgac
gcacgcagggtgttcgtcgaccacgccctcggcgcgcacgaggtcatggaccggctgcgg
gccgcgcggccggcgctgcggatcgagacctgctcgggcggcggcggacgcgtcgacctg
gcgagcctggcccgcaccgatcaggcgtggacgtcggacaacacggacgcggtcgaccgg
ctgggtatccagtacggcttctcgcagctctatcccgcgcaggtgatgggcgcctgggtg
acggacagcccgaacccgatcaccctgcggaccgtgcccctgcgtttccgcctgcacagc
gcgatggccggggcgctcggtatcggcggcgacctgacacgctggccggaggcggaactg
gacgagacggcggcgtacgtagccctgtacaagacggtgcggtccaccgtccagaccggc
cggcagtacaggctgggctccccggcggacagttcccacgccgtgcagtacgtggcgcgc
gacggcgacgagtccgtggtcttccagtggcgggcagggcccgaggaacgcgcggcgttg
ccccgcctgcggctgcgcggccttgttcccgaggccgtgtaccgcgtcgacgacgacagc
gagatcacgcgtgcgggcaccgtgcgcagcggtgccgcgctgatggcgcacggactgtcg
gctcagctcccgcggggcggttacgcgagcaggatgctgacgctgcgccgggaagggtga

DBGET integrated database retrieval system