KEGG   Streptomyces sp. PAMC26508: F750_6972Help
Entry
F750_6972         CDS       T02619                                 

Definition
endo-1,4-beta-xylanase A precursor (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
strp  Streptomyces sp. PAMC26508
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7452858..7454600
Genome map
AA seq 580 aa AA seqDB search
MDLGGGTWRRLTAVALVMAVAAGCTRQGESAGGGNDEDLLRNHDWTQMPGTVARNDILRI
SALDRHIVEQDSSGGQPNPPLNLAGPHLRSDGDFTVTARMSGVGDGGGDSWLRLYGQVPV
IYDEWRQERPSLRVGVTAGGRVKVQIWDGEGDEPVTSKEFDCGCSGTVTVAVSSIGDTFR
LKADGRRLGTVQDPGVFAEGTVWFGLEADASTHERREGWRLTQLIARAESGDSLRVIKAP
QLRQEQSDDSLRARAAEVGRPFDVGTALAENPLLTDSRYRSLAGSQFSMLTPENAFKPQF
LHPRRGVYDFRDADLLVRFARANDMKVHAHTLVWHEALPDWMRENDDPEEVRRTMLRHIA
TVAGHFKGKVAEWDVVNEPMSDDEKSYTNGDLGLRSEQSPWFEAMGEEYIDEAFRAAHRA
DPQARLFLNEYGVEEEGERWDALYDLVTRLKERGVPIDGVGFQNHEYAPGDRIDPETFRS
HVRDLAELGVQARVSEMDVPVGEDEEDGRQIQADEMAGKLRVCLEEPNCTSFSTWGFTDR
YGSTADTKIYPPRTADSLPWDAALRPKPAYERLLDAFDEA
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
gtggaccttggtggggggacgtggcggcggctgaccgccgtggcgctcgtcatggcagtg
gcggccgggtgtacgaggcagggcgaaagcgcgggcggcggaaacgacgaagacctgctg
cggaaccacgactggacgcagatgccgggcaccgtcgcgcggaacgacatcctgcggatc
agcgcattggatcggcacatcgtggagcaggactcctccggcggccagcccaaccccccg
ctgaacctggccggcccgcatctcagatccgacggcgacttcaccgtcaccgcgcgcatg
tccggtgtgggcgacggcggcggcgactcatggctgcgactgtacggacaagtacccgtc
atctacgacgagtggcggcaggaacggccctcactccgcgtcggcgtgaccgccggtgga
cgagtgaaggtacagatatgggacggcgagggcgatgagccggtcacctccaaggaattc
gactgcggttgctccgggacggtcacggtcgccgtgtcgagcatcggtgacaccttccgc
ctgaaagccgacgggcggcggctgggaaccgtgcaggacccgggagtgttcgccgagggc
actgtctggttcggcctggaggcagacgcgagcacacacgaacgccgcgagggatggcgt
ctgacgcagctgatcgcacgggcagagagcggtgactcgctccgcgtgatcaaggcgccg
cagctacgccaggagcagtccgacgactcgctgcgtgcgcgggccgcagaagtagggcgg
ccgttcgacgtcggcaccgcgctggccgagaacccgctgctcaccgactcgcgctaccgg
tcgctcgcgggcagtcagttctccatgcttactccggagaacgcgttcaagccacagttc
ctccacccacgccggggcgtctacgacttccgtgacgcggacctactcgttcgcttcgcc
cgcgcaaacgacatgaaggtgcacgcgcacaccctcgtctggcacgaggctctgcccgac
tggatgcgggagaacgacgaccccgaggaggtgcgccggaccatgctccggcacatcgcc
acggttgccgggcacttcaagggaaaggtcgcggaatgggatgtggtcaacgagcccatg
tccgacgacgagaagagctacaccaacggggatctaggtctgcgctccgagcagagcccg
tggttcgaggccatgggggaggagtacatcgacgaggcgttcagggccgcccaccgggcc
gatccgcaggcacggctgttcctcaacgagtacggggtcgaggaggaaggcgagcggtgg
gacgccctctacgatctggtcacgcggctcaaggaacgcggcgtaccgatcgacggcgtg
ggtttccagaaccacgagtacgcacccggcgaccgcatcgacccggagaccttccgcagc
catgtacgggatctggcggagctcggggttcaggcgcgggtgtcggagatggacgtcccc
gtaggcgaggacgaggaggacgggcggcagatccaggctgatgagatggcgggcaagctg
cgggtctgcctggaggagccgaactgcacatcgttctccacatggggattcaccgaccgg
tacggttctaccgccgacaccaagatctaccctccgcgcacggccgattccctgccgtgg
gacgcggccctgcggccgaagccggcgtacgaacgcctgctcgatgcctttgacgaggcg
tga

DBGET integrated database retrieval system