KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t0418Help
Entry
t0418             CDS       T00121                                 

Gene name
cysM
Definition
cysteine synthase B (EC:2.5.1.47)
Orthology
K12339  
cysteine synthase B [EC:2.5.1.47]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:stt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    t0418 (cysM)
   01230 Biosynthesis of amino acids
    t0418 (cysM)
  Energy metabolism
   00920 Sulfur metabolism
    t0418 (cysM)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    t0418 (cysM)
Enzymes [BR:stt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     t0418 (cysM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
491984..492895
Genome map
AA seq 303 aa AA seqDB search
MNTLEQTIGNTPLVKLQRLGPDNGSEIWVKLEGNNPAGSVKDRAALSMIVEAEKRGEIKP
GDALIEATSGNTGIALAMIAALKGYRMKLLMPDNMSQERRAAMRAYGAELILVTKEQGME
GARDLALAMSERGEGKLLDQFNNPDNPYAHYTTTGPEIWRQTSGRITHFVSSMGTTGTIT
GVSRFLREQEKTVTIVGLQPEEGSSIPGIRRWPTEYMPGIFNASLVDEVLDIHQNDAENT
MRELAVREGIFCGVSSGGAVAGALRVARATPGAIVVAIICDRGDRYLSTGVFGEEHFSQG
AGI
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacattagaacaaaccatcggcaatacgccgctggtcaaattacaacggctgggg
ccggataacggcagtgaaatctgggtcaagctggaaggcaataatccggcaggatcggtg
aaagatcgcgcggcgctatcgatgattgtcgaggcggaaaagcgcggggaaattaaaccg
ggcgatgccctgattgaagcgaccagcggcaacactggcattgcgctggcgatgatcgcc
gcgctgaaaggttatcgcatgaagctgttgatgccggacaacatgagccaggagcgtcgg
gcggcaatgcgggcctatggcgcggaactgattctggtcactaaagagcagggaatggaa
ggggcgcgcgatttagcgctcgctatgtctgagcgcggagaaggtaaactgctcgatcag
tttaataatcctgataatccctacgcccactacacgaccaccggcccggaaatctggcgg
caaacgtcaggtcgcatcacccattttgtctccagcatgggcacgaccggcaccattacc
ggcgtgtcgcgttttctgcgcgagcaggaaaaaacggtcaccatcgttggcctgcaaccg
gaagagggcagcagtattccgggcattcgccgctggcctacggaatatatgccgggcata
tttaacgcctcgctggtggatgaggtgctggatattcatcagaatgatgccgaaaacacc
atgcgtgaactggcggttcgtgaagggattttctgcggcgtcagctccggcggcgcggta
gcgggcgcgttacgcgtcgcacgagccacgcccggcgcgatagtggtggcgatcatctgc
gatcgcggcgaccgttacttgtctaccggcgtgtttggtgaagagcatttcagccagggg
gcagggatttaa

DBGET integrated database retrieval system