KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t0454Help
Entry
t0454             CDS       T00121                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
stt00010  Glycolysis / Gluconeogenesis
stt00052  Galactose metabolism
stt00500  Starch and sucrose metabolism
stt00520  Amino sugar and nucleotide sugar metabolism
stt00521  Streptomycin biosynthesis
stt01100  Metabolic pathways
stt01110  Biosynthesis of secondary metabolites
stt01120  Microbial metabolism in diverse environments
stt01130  Biosynthesis of antibiotics
stt01200  Carbon metabolism
Module
stt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
stt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:stt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    t0454 (glk)
   00052 Galactose metabolism
    t0454 (glk)
   00500 Starch and sucrose metabolism
    t0454 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    t0454 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    t0454 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    t0454 (glk)
Enzymes [BR:stt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     t0454 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: AAO68166
UniProt: P58618
Position
525173..526138
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVVRVYLDEHGVSVEDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GGEPVDGKPIAVYGAGTGLGVAHLVHVDKRWISLPGEGGHVDFAPNSEEEAMILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKSDNRLPENLRPKDITERALADSCIDCRRALSLFCVI
MGRFGGDLALTMGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKDYVHGIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgctttagtaggagatgtaggcggcacgaatgcgcgtcttgccctgtgt
gatatcgccagtggagaaatctcgcaggccaaaacgtattccggcctggattaccccagt
cttgaggccgtggtgcgcgtttatctcgatgagcatggcgtcagcgtggaagatggttgt
atcgccatagcctgcccgattaccggcgactgggtggcgatgactaaccatacctgggct
ttttctattgcggaaatgaaaaaaaatctcggctttagtcatctggaaatcatcaacgat
ttcaccgccgtgtcgatggcgatcccgatgctgaaaaaagagcatttaattcagttcggc
ggcggcgaaccggtagacggcaaacctattgcggtgtacggcgcgggaaccggcttgggc
gtggcgcatctggtgcatgtggataagcgttggattagccttccgggcgaaggcgggcat
gtcgattttgcgcctaatagcgaagaagaagctatgattctggaaatattgcgcgccgaa
attggccacgtttccgccgagcgcgtgctgtctggcccggggctggtgaatctttaccgg
gcgattgttaagtccgacaaccgtctgccggaaaatctgcgcccgaaagatattaccgaa
cgcgccctggcggatagctgtatcgattgtcgccgcgcgttgtcgctcttttgcgtcatc
atggggcgatttggcggcgatctggcgttaaccatggggacatttggcggcgtttatatc
gctggcggcattgtcccgcgcttcctggaattctttaaagcgtctggcttccgtgggggc
tttgaagataaaggccgctttaaagattatgtacacggtattccggtctatctgattgtc
catgataatcccggcttgttaggctccggcgcgcatctgcgccagacattaggccatatt
ctataa

DBGET integrated database retrieval system