KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t0778Help
Entry
t0778             CDS       T00121                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    t0778 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    t0778 (rfbC)
Enzymes [BR:stt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     t0778 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
870270..870821
Genome map
AA seq 183 aa AA seqDB search
MMIVIKTAIPDVLILEPKVFGDERGFFFESYNQQTFEESIGRKVTFVQDNHSKSKKNVLR
GLHFQRGENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAH
GFVTLSDYAEFLYKATNYYSPSSEGSILWNDETIGIEWPFSQLPELSAKDAAAPLLHQAL
LTE
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtgatgattgtgattaaaacagcaataccagatgtcttgatcttagagcctaaagttttt
ggcgatgagaggggattcttttttgaaagttataaccagcagacctttgaagagtcgatt
ggacgtaaagttacatttgttcaagataatcattcaaaatccaaaaagaatgtactcaga
gggctacattttcagagaggagaaaatgcacagggaaagttagttcgctgtgctgtcggt
gaggtttttgatgttgcggtcgatatccgaaaagaatcacctacttttggtcagtgggtt
ggcgtaaatctatctgctgagaataagcgacagctttggattccagaaggttttgctcat
ggttttgttactctcagtgattatgcagagtttctgtacaaagcaactaattattactca
ccttcatcggaaggtagcattctatggaatgatgagacaataggtattgaatggcctttt
tctcagctgcctgagctttcagcaaaagatgctgcagcacctttactgcatcaagccttg
ttaacagagtaa

DBGET integrated database retrieval system