KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t0784Help
Entry
t0784             CDS       T00121                                 

Gene name
rfbE
Definition
(GenBank) CDP-tyvelose-2-epimerase
  KO
K12454  
CDP-paratose 2-epimerase [EC:5.1.3.10]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:stt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    t0784 (rfbE)
Enzymes [BR:stt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.10  CDP-paratose 2-epimerase
     t0784 (rfbE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
875885..876901
Genome map
AA seq 338 aa AA seqDB search
MKLLITGGCGFLGSNLASFALSQGIDLIVFDNLSRKGATDNLHWLSSLGNFEFVHGDIRN
KNDVTRLITKYMPDSCFHLAGQVAMTTSIDNPCMDFEINVGGTLNLLEAVRQYNSNCNII
YSSTNKVYGDLEQYKYNETETRYTCVDKPNGYDESTQLDFHSPYGCSKGAADQYMLDYAR
IFGLNTVVFRHSSMYGGRQFATYDQGWVGWFCQKAVEIKNGINKPFTISGNGKQVRDVLH
AEDMISLYFTALANVSKIRGNAFNIGGTIVNSLSLLELFKLLEDYCNIDMRFTNLPVRES
DQRVFVADIKKITNAIDWSPKVSAKDGVQKMYDWTSSI
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttttaattaccggtggatgtggcttccttgggagtaatcttgcctcctttgct
ttaagtcaagggattgatttaattgtattcgataatctatcacgtaaaggtgcaacagat
aatttacattggttatcctccttaggaaactttgagtttgtacatggtgatattcgcaac
aaaaatgatgttacaagattaataactaagtatatgcctgatagctgttttcatcttgca
ggtcaagtggcaatgactacatctattgacaatccttgtatggattttgaaattaatgta
ggtggaactttaaatttacttgaggcagtacggcagtataattcaaattgtaatataatt
tattcatcaacaaataaagtatacggcgatcttgagcaatataaatacaatgaaacagaa
actagatacacttgtgtagataagcctaatggatatgatgagagcacacaattagatttc
cactcaccatatggttgttcaaaaggtgctgcagaccaatacatgcttgattatgcaagg
atttttggtttgaatacagtggtgttcaggcattcatcaatgtatggtgggagacagttt
gctacttatgatcaaggctgggtaggttggttttgtcaaaaagcggttgaaattaaaaat
ggtattaataaacccttcactatttctggtaatggtaagcaagttagggatgttttgcat
gctgaagatatgatttcgttatatttcactgccttggcaaatgtatcaaaaattaggggg
aacgcttttaatattggtggtaccattgtcaacagcctatcattacttgaattattcaaa
ttgcttgaagattattgcaacatagatatgaggttcactaatttacctgtaagggaaagt
gatcagcgtgtttttgttgcagatattaaaaaaatcactaatgcaattgactggagcccg
aaagtctcggcaaaagatggtgtccagaaaatgtatgattggactagttctatatga

DBGET integrated database retrieval system