KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t0871Help
Entry
t0871             CDS       T00121                                 

Definition
hypothetical protein
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Brite
Enzymes [BR:stt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     t0871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(970921..973881)
Genome map
AA seq 986 aa AA seqDB search
MKLHFESDLTYQQNAITSVCDLFEGQEKWESEMTVLAPAQGALSFEGATGSMPVNPQIPE
DDVLLKNLNNVQLKNQLPPSPVLDSHDFTVEMETGTGKTYVYLRTMLELNKRYGMSKFII
VVPSVAIKEGVYKTLQITEEHFKSLFAGVPYEYYLYDSAKPADVRNFATSSVMQIMVMTV
GAINKKDVNKLYQSSEKTTVDDLDKPIDLIRATRPIIIVDEPQSVDGGLNGAGKTALDAM
HPMFTLRYSATHVHKHHMVYRLDAIDAYNQKLVKQIEVAGLEVQNASNSPYVKLVSINNK
KNSISATVIVDIADKKGNVNRSEITVYDGMTLDDETGRDIYQGYRISEIRTGKEGYLTLE
TPSDTYYMKVGDVVGDIDPMLIQRHMIRRTIREHLDKELRLNTQQIKVLTLFFIDKVDLY
RQTNEEGVREPGEYARIFEEEYLKAIKSPAYKDLLPSHPEHAKDVHDGYFSIDKKGAWAE
TSESNNTGRENAERGYNLIMKNKEKLLSFSNPVRFIFSHSALKEGWDNPNVFQICSLREM
GSERERRQTLGRGLRLCVNQEGERVRDDSINILTVVASENYEAYAERLQSEIESETGIRF
GVIEKDAFAHLIFADSSQGLGISGSHDIWSELQTEGYIEKSGKITKTLKKELFENTFVVS
EKYASLQEQIETILRKSAGRLNINNADERKTIKYRKEVLNSPEFEALWQRICQKTLYRLA
FDEEELIKSCTKSLSEMQPVAKAMVSFSKATIKQSQSGLDVKALSNGTTSSVVDVAEQPL
PDILGVLQEKTGLTRRSLSTILKESGRLADFAKNPQQFISEAIGRINYCKRLSIVDGIKY
YPLKGEVYAQSLFMDKELTGYARNLFETSSKSVYEYVPKDSEVESRFAQELEEQDEVKLY
VKLPGWFKIPTPLGTYNPDWALVIEDNGEEHIYFVVETKSKHIGLGHEEDAKIACGTAHF
SALKAEKINAAKYVRATAITEIMSSL
NT seq 2961 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacattttgaatctgaccttacctatcagcaaaacgccataacatcggtctgt
gatttgtttgaagggcaagagaaatgggaaagcgaaatgactgtgctggccccagctcag
ggtgcactctcatttgaaggcgcaacaggttcaatgcctgttaacccacaaatacccgaa
gatgatgtactgcttaaaaatctgaacaatgttcagttaaaaaaccagcttccaccttca
cctgtgctcgacagccatgattttactgtcgaaatggaaacagggacaggtaaaacgtat
gtttatcttcgcaccatgctggagctgaataaacgctatggcatgagtaaatttattatt
gtggttccttcagttgctatcaaggaaggcgtttataaaacactacaaataactgaagaa
cattttaaaagcctgtttgcgggagttccatacgaatactatctgtatgattcggcaaaa
cctgcggatgttcgaaattttgcaaccagttctgttatgcagatcatggtaatgactgtg
ggtgcgattaacaaaaaagatgttaacaagctctatcagtccagtgaaaaaacaactgtg
gacgatctggataagcccattgatttaatccgtgctacacgtccaattattattgtcgat
gaaccgcaaagtgttgatggtggcttgaacggtgcgggtaaaaccgcacttgatgctatg
caccccatgttcaccttacgctattcagcaacacatgttcataaacatcatatggtgtac
cgccttgacgccattgatgcttacaaccaaaaactggtcaaacagatcgaggttgccggg
cttgaagtccaaaatgcaagtaatagcccctatgtaaaactggtcagtattaacaataag
aagaatagcattagtgcgactgttattgttgatatagccgataaaaaagggaacgtaaat
cgttcagagattaccgtatatgacggtatgacactcgatgacgaaacaggacgtgatatt
tatcagggttaccggataagcgagatccgaactggcaaagagggttatcttacactggaa
acaccttctgatacctactatatgaaagtcggtgatgtcgtgggggatattgaccctatg
ctcatccagcgtcatatgatcagacgtacaatccgtgaacatctggataaagaacttcgc
ctgaatactcagcaaatcaaggttcttaccctgtttttcattgataaggttgatttatat
cgtcagaccaatgaagaaggagtacgtgaaccgggtgaatatgcccgtatctttgaagaa
gaatatcttaaagcaatcaaaagccctgcctataaagatttacttccttctcatccagaa
catgccaaagatgttcatgatggttatttctccattgataaaaaaggtgcatgggctgaa
acaagcgaaagcaataatacaggccgtgaaaatgctgagcgtggttataatctcattatg
aaaaataaagagaagcttttgagtttctcgaatccagtgaggtttattttttcgcactct
gctttgaaagaaggctgggataaccccaatgtattccagatctgtagcctccgagagatg
ggaagtgaacgagaacgtcgtcaaacattaggccgtggtcttcgcctgtgtgttaaccaa
gagggtgaacgtgttcgtgatgacagcattaacattctgacagtcgttgccagtgaaaat
tatgaagcctacgctgaacgattacagtctgaaattgagagcgaaacaggcatacgtttt
ggtgtgattgaaaaagatgcgttcgcccatcttatcttcgctgattcctcacaaggttta
ggtatttccggttcacatgatatctggtctgaacttcagactgaaggttatattgaaaaa
tcgggaaaaattaccaaaaccctgaaaaaagaattattcgaaaacacttttgttgttagt
gagaagtatgcctcactacaggaacaaattgaaactatcctgcgtaaatcagcagggcga
ctcaatataaacaatgctgatgaacgtaaaacaatcaaataccggaaagaagtcttaaac
agcccggaattcgaagcgttatggcagcgcatttgtcaaaaaacgctgtatcggctagca
tttgatgaagaagaattgatcaaatcctgtacgaaatcactttctgaaatgcagcctgta
gcaaaagcaatggtcagtttcagcaaagcaacaatcaaacaaagtcaatctggccttgat
gttaaagctctgtctaatggaacaacaagctctgtagttgatgttgcagagcagccattg
ccagatattcttggtgttctacaggaaaaaaccggactgacaagacgcagtttaagcacc
atcctgaaagagagtggaagactcgctgattttgctaaaaatccacagcagtttatcagt
gaagctataggccgaatcaactactgcaaacgcctgtcaattgttgatggtattaaatat
tatccactaaaaggagaggtgtatgcgcaaagtctctttatggataaagagctaacagga
tatgcccgtaatctttttgaaacctcgtctaagtcagtttacgaatacgttcctaaagat
tctgaagtcgaaagccgtttcgctcaggaactcgaagaacaggatgaagttaagctttat
gtgaagctgccgggatggtttaaaatcccgacgccactgggaacctacaatcctgactgg
gcgttagttattgaagacaatggtgaagaacatatttactttgttgtagagacaaaaagt
aaacacattggtcttggtcatgaagaagatgcgaagatagcctgtggaactgcgcatttt
agtgctttaaaagcagaaaaaatcaatgcagcaaaatatgttcgagccacagccattaca
gaaataatgagcagcctttaa

DBGET integrated database retrieval system