KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t0923Help
Entry
t0923             CDS       T00121                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:stt00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1019218..1020204
Genome map
AA seq 328 aa AA seqDB search
MPLHHLTRFPRLELIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNKLRKLEFLVA
DALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLD
LFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIVQQC
EEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAG
QLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLANLEGVLLDPVYTGKAMAGLIDGIS
QKRFNDDGPILFIHTGGAPALFAYHPHV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccactacatcacttaacgcgctttcctcgcctggagcttattggcgcgccgaccccg
ctcgaatacctgccgcgattgtctgattatcttggccgtgagatttacattaagcgcgat
gacgttacgcccattgcaatgggcggcaataaactgcgtaagctggagtttctagtggcc
gacgcgctgcgagaaggggcggatacgctgataaccgcaggggcgattcagtcaaaccat
gtccgtcagacggcggcggttgcggccaaattggggctgcattgcgtcgccttgctggaa
aatccaatcggtaccaccgcggaaaattacctgacgaatggtaatcgcctgttactggat
ttatttaatacacaaattgagatgtgcgatgcgctaaccgatccggatgcgcagctgcaa
acgctggcgacgcgcattgaagcgcaagggttcaggccctatgtgattccggtcggcggc
tccagcgcgttgggcgcaatgggatacgtagagagcgccctggagatcgtccagcagtgt
gaagaggtcgtcgggctctcttcggtggtggtggcctccggcagcgccggaacgcacgcc
gggttagctgtcgggctggaacatctgatgccggatgtcgaactgattggcgtgaccgtt
tcacgttctgtcgccgagcagaaacccaaagtgattgccttgcagcaggctattgccggc
cagctggcgctgacggcgacggcggatattcatttatgggatgactattttgccccgggt
tacggcgtgccaaatgacgcggggatggaggcggtgaaactgctggcgaacctggagggg
gtgctgctggatccggtatataccggtaaagcgatggcgggtctgatagatggcatcagc
cagaaacgctttaacgatgacgggccgattctctttattcataccggtggggcgcctgcg
ctgtttgcctaccatcctcatgtataa

DBGET integrated database retrieval system