KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t1097Help
Entry
t1097             CDS       T00121                                 

Gene name
ipk
Definition
(GenBank) isopentenyl monophosphate kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
stt00900  Terpenoid backbone biosynthesis
stt01100  Metabolic pathways
stt01110  Biosynthesis of secondary metabolites
stt01130  Biosynthesis of antibiotics
Module
stt_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:stt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    t1097 (ipk)
Enzymes [BR:stt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     t1097 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AAO68760
UniProt: Q8Z699
Position
complement(1182035..1182886)
Genome map
AA seq 283 aa AA seqDB search
MMTHWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTLHIEPRHDGEIHLLTPVTGV
ENEDNLIVRAARLLMKVASESGRLPAGSGADISIEKRLPMGGGLGGGSSNAATVLVALNH
LWQCGLSIDELATLGLTLGADVPVFVRGHAAFAEGVGEILTPVNPPEKWYLVAHPGVSIP
TPVIFKDPQLPRNTPKRSIDTLLKCEFSNDCEVIARKRFREVDAALSWLLEYAPSRLTGT
GACVFAEFDTESCARQVLEQAPEWLNAFVAKGVNLSPLHRELL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgatgacccattggccttctccggcaaaattaaatctgtttttatatatcaccggacag
cgtgcagacggctaccacacgctgcagacgctgtttcagtttctggattatggcgacaca
ctccacatcgaaccgcgtcacgatggcgaaatccatttattaacgccggtaaccggcgtt
gaaaatgaagacaatctgatcgtccgcgccgcgcggctgttgatgaaagtcgcctcggag
agtggacgcctgcccgccggaagcggcgcggatatcagcattgagaagcgccttcccatg
ggcggcggtctgggtggcggctcgtctaacgccgcgaccgttctggtggcgctcaatcat
ctttggcaatgcgggctttccattgatgaactggcgacgctcggcctgacgctcggcgcc
gacgtcccggtctttgttcgtggccacgccgcgtttgccgaaggcgtaggcgaaatatta
acgccggtgaatccgccggaaaaatggtatctggtcgcgcaccctggcgtaagcattccg
acgccagttatctttaaagatcctcaattgccgcgtaatacgccaaaaaggtcaatagat
acgttactaaaatgtgaattcagcaatgattgcgaggttatcgcaagaaaacgttttcgc
gaggttgatgcggcgctttcctggctgttagaatacgcgccgtcgcgcctgactgggaca
ggggcctgtgtctttgctgaattcgatacagagtcttgtgctcgccaggtgcttgagcaa
gccccggaatggctcaatgcttttgtggcgaagggtgttaacctttccccattgcatcga
gagttactctaa

DBGET integrated database retrieval system