KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t1339Help
Entry
t1339             CDS       T00121                                 

Gene name
rstB
Definition
(GenBank) two component sensor kinase
  KO
K07639  
two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
Two-component system
Module
RstB-RstA two-component regulatory system
Brite
KEGG Orthology (KO) [BR:stt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    t1339 (rstB)
Enzymes [BR:stt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     t1339 (rstB)
Protein kinases [BR:stt01001]
 Histidine protein kinases
  OmpR family
   t1339 (rstB)
Two-component system [BR:stt02022]
 OmpR family
  RstB-RstA [MD:M00446]
   t1339 (rstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1400397..1401701)
Genome map
AA seq 434 aa AA seqDB search
MMKKLFVQFYLLLFVCFLVMTLLVGLVYKFTAERAGRQSLDDLMKSSLYLMRSELREIPP
REWGKTLKEMDLNLSFDLRVEPLNHYKLDAATTQRLREGDIVALDDQYTFIQRIPRSHYV
LAVGPVPYLYFLHQMRLLDIALMALIAFSLAFPVFIWMRPHWQEMLRLESAAQRFGEGHL
TERLHFDNGSSFERLGVAFNQMADNINALIASKKQLIDGIAHELRTPLVRLRYRLEMSEN
LTPPESQALNRDIGQLEALIEELLTYARLDRPQNELMLTKPDLPAWLFAHLQDVQSVNPE
RAVNLLTCVIGDYGALDMRLMSRVLDNLLNNALRYSRTTVQVSLLLDGSQATLIVEDDGP
GIEADARERVFEPFVRLDPSRDRATGGCGLGLAIVHSIALAMGGSVVCDDSELGGAKFSF
RWPVWHAMPDMTAA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaaaaagctgtttgtgcagttttaccttttgctgttcgtctgttttctggtcatg
accttattggtcggactggtgtacaaattcactgccgaacgcgcgggcaggcaatcgctc
gacgatctgatgaaaagttcgctctatctgatgcgcagcgaactgcgggaaattccgccg
cgtgaatgggggaaaacgttaaaagagatggacctgaacctctctttcgatttacgcgtt
gaaccgttaaatcactataagcttgatgccgccaccacgcagcgactgcgtgaaggcgat
attgtcgcgcttgacgatcaatacacctttattcagcgtatcccgcgcagccattacgtc
ctggcggttggcccggttccctatctctatttcctgcatcaaatgcgactgctggatatc
gccttaatggcgctcattgccttttctctcgcctttcctgtgtttatctggatgcgcccg
cactggcaagaaatgctcaggctcgaatccgccgcgcagcgctttggcgagggtcatttg
actgaacgcctgcatttcgataatggttccagtttcgaacgtctgggcgtcgcgttcaac
cagatggcggataacattaatgctctgatcgccagtaaaaaacagctgattgacggtatc
gcccatgagcttcgcacgccgctggtacgtttacgctatcggcttgaaatgagtgaaaat
ctgactccgccggaatcacaggcgctcaatcgcgatattggtcaactggaagcgctgatt
gaagaactgctcacctatgcgcgccttgaccgaccacaaaatgaactgatgttgaccaaa
cccgacctccccgcctggttgttcgcgcatttgcaggatgtgcagagcgtgaacccggaa
cgcgccgtaaatcttctcacatgtgtaatcggcgattatggcgcgcttgatatgcggtta
atgtcgcgagtgctggataacctgctgaataatgcgttgcgctacagccgtaccaccgtt
caggtcagtctgttacttgacggcagtcaggcaacgctgatagtcgaagatgatggcccc
ggcattgaagcggatgcgcgagagcgcgtatttgaaccttttgtcagactcgaccccagt
agagaccgggcgacaggcggctgcgggcttggactcgccatcgtacactctatcgctctg
gcgatgggcggtagcgtcgtctgtgacgatagcgaactgggcggcgcaaaatttagcttt
cgctggccggtctggcacgcgatgcccgacatgaccgcggcctga

DBGET integrated database retrieval system