KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t1339Help
Entry
t1339             CDS       T00121                                 

Gene name
rstB
Definition
sensor protein RstB
Orthology
K07639  
two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
Two-component system
Module
RstB-RstA two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:stt02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1400397..1401698)
Genome map
AA seq 433 aa AA seqDB search
MKKLFVQFYLLLFVCFLVMTLLVGLVYKFTAERAGRQSLDDLMKSSLYLMRSELREIPPR
EWGKTLKEMDLNLSFDLRVEPLNHYKLDAATTQRLREGDIVALDDQYTFIQRIPRSHYVL
AVGPVPYLYFLHQMRLLDIALMALIAFSLAFPVFIWMRPHWQEMLRLESAAQRFGEGHLT
ERLHFDNGSSFERLGVAFNQMADNINALIASKKQLIDGIAHELRTPLVRLRYRLEMSENL
TPPESQALNRDIGQLEALIEELLTYARLDRPQNELMLTKPDLPAWLFAHLQDVQSVNPER
AVNLLTCVIGDYGALDMRLMSRVLDNLLNNALRYSRTTVQVSLLLDGSQATLIVEDDGPG
IEADARERVFEPFVRLDPSRDRATGGCGLGLAIVHSIALAMGGSVVCDDSELGGAKFSFR
WPVWHAMPDMTAA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctgtttgtgcagttttaccttttgctgttcgtctgttttctggtcatgacc
ttattggtcggactggtgtacaaattcactgccgaacgcgcgggcaggcaatcgctcgac
gatctgatgaaaagttcgctctatctgatgcgcagcgaactgcgggaaattccgccgcgt
gaatgggggaaaacgttaaaagagatggacctgaacctctctttcgatttacgcgttgaa
ccgttaaatcactataagcttgatgccgccaccacgcagcgactgcgtgaaggcgatatt
gtcgcgcttgacgatcaatacacctttattcagcgtatcccgcgcagccattacgtcctg
gcggttggcccggttccctatctctatttcctgcatcaaatgcgactgctggatatcgcc
ttaatggcgctcattgccttttctctcgcctttcctgtgtttatctggatgcgcccgcac
tggcaagaaatgctcaggctcgaatccgccgcgcagcgctttggcgagggtcatttgact
gaacgcctgcatttcgataatggttccagtttcgaacgtctgggcgtcgcgttcaaccag
atggcggataacattaatgctctgatcgccagtaaaaaacagctgattgacggtatcgcc
catgagcttcgcacgccgctggtacgtttacgctatcggcttgaaatgagtgaaaatctg
actccgccggaatcacaggcgctcaatcgcgatattggtcaactggaagcgctgattgaa
gaactgctcacctatgcgcgccttgaccgaccacaaaatgaactgatgttgaccaaaccc
gacctccccgcctggttgttcgcgcatttgcaggatgtgcagagcgtgaacccggaacgc
gccgtaaatcttctcacatgtgtaatcggcgattatggcgcgcttgatatgcggttaatg
tcgcgagtgctggataacctgctgaataatgcgttgcgctacagccgtaccaccgttcag
gtcagtctgttacttgacggcagtcaggcaacgctgatagtcgaagatgatggccccggc
attgaagcggatgcgcgagagcgcgtatttgaaccttttgtcagactcgaccccagtaga
gaccgggcgacaggcggctgcgggcttggactcgccatcgtacactctatcgctctggcg
atgggcggtagcgtcgtctgtgacgatagcgaactgggcggcgcaaaatttagctttcgc
tggccggtctggcacgcgatgcccgacatgaccgcggcctga

DBGET integrated database retrieval system