KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t1732Help
Entry
t1732             CDS       T00121                                 

Gene name
rluC
Definition
23S rRNA pseudouridylate synthase C
Orthology
K06179  
23S rRNA pseudouridine955/2504/2580 synthase [EC:5.4.99.24]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1797105..1798064)
Genome map
AA seq 319 aa AA seqDB search
MKTETPSVKIVAIAADEAGQRIDNFLRTQLKGVPKSMIYRILRKGEVRVNKKRIKPEYKL
ESGDEVRIPPVRVAEREEEAVSPHLQKVAALADVILYEDDHILVLNKPSGTAVHGGSGLS
FGVIEGLRALRPEARFLELVHRLDRDTSGVLLVAKKRSALRSLHEQLREKGMQKDYLALV
RGQWQSHVKTVQAPLLKNILQSGERIVRVSQEGKPSETRFKVEERYAFATLVRCSPVTGR
THQIRVHTQYAGHPIAFDDRYGDREFDQQLTEAGTGLKRLFLHAAALKFTHPGTGDVMRI
EAPMDKQLKRCLEVLRSKA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagaaacgccatccgtaaaaattgttgctatcgccgctgacgaagcggggcaa
cgcattgataactttttgcgcacccaactgaaaggggtaccaaaaagtatgatttatcgc
atcttgcgtaaaggcgaggtgcgggtgaacaaaaaacgcattaaaccggaatacaaactg
gaatcgggcgatgaagtccgcattccgccggttcgcgttgctgagcgcgaagaagaggct
gtgtcgccgcatttgcaaaaagtggcggcgttggcggacgtcattttgtatgaagacgac
catattctggtgctgaataagccttccggcaccgccgtacacggtgggagcgggttaagt
ttcggcgtcatcgaagggctgcgggcgttgcgtccggaagcgcgattcctggaactggtg
catcgtcttgaccgcgatacttccggcgtgctgttggtggcgaaaaaacgctccgcgctg
cgttcgctgcatgagcaactgcgcgaaaagggaatgcagaaagattatctggcgctggtg
cgcggccagtggcaatcacacgttaaaaccgtacaggcgccattattaaagaacattctg
caaagcggcgaacgcattgtccgcgtgagccaggaaggcaaaccttcagaaacgcgcttc
aaggtggaagagcgttatgccttcgccacgctggtgcgctgtagcccggtcacgggccgt
acgcatcagattcgcgtacatacccaatatgccggtcaccctattgcgttcgacgatcgc
tacggcgaccgtgagtttgatcaacagcttaccgaagcgggaaccggtcttaaacgtctc
tttctgcacgccgcggcgctgaagttcacgcatccgggaacgggcgatgtcatgcgcatt
gaagcgccaatggataagcaattgaagcgctgccttgaggtattacgtagtaaagcctga

DBGET integrated database retrieval system