KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t2115Help
Entry
t2115             CDS       T00121                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
stt00010  Glycolysis / Gluconeogenesis
stt00260  Glycine, serine and threonine metabolism
stt00680  Methane metabolism
stt01100  Metabolic pathways
stt01110  Biosynthesis of secondary metabolites
stt01120  Microbial metabolism in diverse environments
stt01130  Biosynthesis of antibiotics
stt01200  Carbon metabolism
stt01230  Biosynthesis of amino acids
Module
stt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
stt_M00002  Glycolysis, core module involving three-carbon compounds
stt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:stt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    t2115 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    t2115 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    t2115 (gpmA)
Enzymes [BR:stt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     t2115 (gpmA)
Membrane trafficking [BR:stt04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    t2115 (gpmA)
Exosome [BR:stt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   t2115 (gpmA)
  Exosomal proteins of melanoma cells
   t2115 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AAO69732
UniProt: Q8Z8B2
Position
2179378..2180130
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgtcacggtgaaagtcaatggaacaaagagaac
cgtttcaccggctggtatgatgttgacctgtctgaaaaaggcgtaagcgaagcaaaagca
gcgggtaaactgctaaaagaagaaggtttcagctttgattttgcctacacttccgtactg
aaacgcgctatccatacgctgtggaacgtactggatgaactggatcaggcgtggctgccg
gtggaaaaatcctggaaactcaatgaacgtcactatggcgcgttgcaagggctgaataaa
gcggaaacggcagaaaaatatggtgacgagcaggttaagcagtggcgccgcggttttgcc
gtgacgccgccggaactgaccaaagatgatgagcgttatccgggtcacgatccacgttat
gccaaactgagcgagaaagagctgccgttgaccgaaagtctggcgctgaccatcgaccgc
gttattccttactggaacgacaccatcctgccgcgtatgaagagcggtgagcgcgtgatc
atcgccgctcacggtaactcattgcgtgcgctggtgaaatacctggataacatgagtgaa
gatgagattcttgagttaaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaagccgatcaaacattactatctgggtaacgctgacgaaatcgccgcgaaagcg
gctgccgtggcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system