KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t2195Help
Entry
t2195             CDS       T00121                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:stt00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2264488..2266152
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVFDIKTDAAELRKKALELSRLMRHRGPDWSGIYACDNAILAHERLSIVDVNAGA
QPLYNAKKTHVLAVNGEIYNHQTLRAEYGDRYAFQTGSDCEVILALYQEKGPDFLDDLQG
MFAFALYDSEKDAYLIGRDHIGIIPLYMGYDEFGNFYVASEMKALTPVCRTIKEFPAGSY
LWSKDGEIRQYYQRDWFDYDAVKDNVTDKNALRQALEESVKSHLMSDVPYGVLLSGGLDS
SVISAITKKFAARRVEDQERSEAWWPQLHSFAVGLEGSPDLKAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLQALHMYDCTRANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGNGKMEKHVLRECFESYLPASVAWRQKEQFSDGVGYSWIDTLKEVAAKQISDQQLET
ARFRFPYNTPSSKEAYLYREIFEELFPVPSAAECVPGGPSVACSSAKAIEWDEAFKTMDD
PSGRAVGVHQSAYQ
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctattttcggcgtattcgatatcaaaacagatgcagcggaactgcgtaaaaaa
gcccttgaattgtcacgcctgatgcgccatcgcggcccggactggtccggcatctacgct
tgcgataacgcgattctcgcacatgaacgcttgtcgattgttgatgttaacgccggcgcc
cagcccctgtataacgctaagaaaactcacgtgctggcggtgaacggtgaaatttataac
catcagacgttacgcgcggagtatggcgatcgttacgcgttccagactggctccgactgc
gaagttattctcgcgctatatcaggaaaaagggccggatttccttgacgatttacagggg
atgttcgccttcgccctgtatgacagcgaaaaagacgcttatctgattggtcgtgaccat
atcggtattattccgctctacatgggctatgacgaattcggcaacttctacgtagcgtca
gaaatgaaagcgctgactccggtctgccgcaccattaaagagttcccggcgggcagctac
ctgtggagcaaagacggcgaaattcgtcagtactatcagcgcgactggttcgattacgat
gcggtaaaagataacgtcaccgacaaaaacgcgctgcgtcaggcgctggaagaatccgtg
aaaagccacctgatgtccgacgtgccctacggcgtactgctctccggcggcctggactcg
tcggttatctcggcaatcaccaaaaaattcgccgcccgtcgcgtcgaagatcaggagcgc
tccgaagcctggtggccacagttgcactcttttgcggtaggtctggaaggttcgcctgac
ctgaaggcggcccaggaagtggctaaccacctcggcaccgtgcatcatgaaattcacttc
accgtccaggagggtctggatgcgattcgcgacgtgatttaccacattgaaacctatgac
gtaaccactatccgcgcctcaacgccaatgtatctgatgtcgcgtaagatcaaagcgatg
ggcatcaaaatggtgctctccggcgaaggttctgatgaggtgtttggcggctacctgtac
ttccataaagcgccgaacgccaaagagttacatgaagagacggtccgtaagctacaggcg
ctgcatatgtatgactgcacccgcgccaacaaagcgatgtccgcctggggcgtggaagcg
cgcgtaccgttcctggataaaaaattcctcgacgtggcgatgcgtatcaacccacaggat
aaaatgtgcggcaacggcaagatggaaaaacacgtgctgcgcgagtgcttcgagtcttat
ctgccagcaagcgtggcgtggcgtcagaaagagcagttctctgacggcgtaggctacagc
tggattgatacgctgaaagaggtggcggcgaaacagatttccgatcaacaactggaaaca
gcccgcttccgctttccatacaacacgccgtcgtctaaagaggcgtacttgtaccgggaa
atttttgaagaattgttcccggtgccgagcgccgcggaatgcgtacccggcggcccgtcc
gtggcctgttcttccgccaaagccattgagtgggatgaagcattcaaaacgatggatgac
ccgtcaggccgcgcggtcggcgtgcatcagtcggcgtaccagtaa

DBGET integrated database retrieval system