KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t2353Help
Entry
t2353             CDS       T00121                                 

Gene name
tesA
Definition
multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:stt01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2421409..2422023
Genome map
AA seq 204 aa AA seqDB search
MNFNTVFRWHLPFLFLILLTFRAAAADTLLILGDSLSAGYRMTASAAWPSLLNDKWQNKT
SVVNASISGDTSQQGLARLPALLQQHHPRWVVVELGGNDGLRGFAPAQTEQTLRKIIQTV
KAADAQPLLMQIHLPANYGRRYNESFSAIYPKLAKEFDIPLLPFFMEEVYLKPQWMQDDG
IHPNRDAQPFIADWMAKQLTPFLS
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaacactgttttccgctggcatttgcccttcctgtttttgatcctgttaact
ttccgtgccgccgccgcagacaccttattaattctgggcgatagcctcagcgccggttac
cgtatgaccgccagcgcggcatggccgtcgctccttaatgataaatggcaaaacaaaacg
tcggtcgttaatgccagtataagcggggatacctcgcagcagggactggcgcgtttgccg
gcgctgttgcaacagcatcacccgcgctgggtagtggtggagcttggcggcaacgatggc
ctacgcggttttgcgcctgcgcaaaccgaacagacgctacgtaaaatcattcagacggtg
aaagccgccgatgcccaaccgttactgatgcaaattcatctgcccgctaactacggtcgc
cgttataatgaatcctttagcgccatttatcctaagctcgccaaagagttcgatattcct
ctattaccgttttttatggaagaggtatatctgaaaccacagtggatgcaggatgacggt
attcatcccaaccgcgacgcgcagccgtttattgccgactggatggcgaagcagttgacc
ccttttctctcctga

DBGET integrated database retrieval system