KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t2374Help
Entry
t2374             CDS       T00121                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:stt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    t2374 (recR)
DNA repair and recombination proteins [BR:stt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      t2374 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2444436..2445041)
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQDVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLASEKISELILATNPTVEGEATANYIAELCAEAGVEASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIIF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtccgctgttaactcagcttatggaagcgttgcgctgccttccgggcgtc
ggccctaagtcggcgcaacggatggcgtttaccctgttgcagcgcgatcgtagcggcgga
atgcgcctggcgcaggcgctgacccgggcgatgtcggaaatcggccactgcgccgactgc
cgcacctttaccgagcaggatgtttgtaatatctgttcgaacccgcggcgccaggaaaac
ggccagatttgcgtggtggagagtcctgcggatatctacgccattgagcagaccgggcaa
ttttccgggcggtatttcgtgctgatgggccacctgtcgccgctggacggcatcgggccg
gatgatatcggtctcgatcgtctggaacagcggctggcgtcagaaaaaatcagcgagctg
atcctcgcgaccaacccgacggttgaaggggaggctaccgcgaactatattgccgagctg
tgcgcggaggccggcgtcgaagccagtcgtatcgcccacggcgtgccggttggcggcgaa
ctggagatggtcgacggtacgacgctgtcccactcgctggcgggacgccataagattatt
ttctga

DBGET integrated database retrieval system